PDB entry 4ama

View 4ama on RCSB PDB site
Description: Crystal Structure of N-acetylneuraminic acid lyase from Staphylococcus aureus with the chemical modification thia-lysine at position 165 in complex with pyruvate
Class: lyase
Keywords: lyase, conversion on pyruvate and d-acetyl mannosamine to n-acetylneuraminic acid
Deposited on 2012-03-08, released 2013-01-23
The last revision prior to the SCOPe 2.02 freeze date was dated 2013-03-27, with a file datestamp of 2013-03-22.
Experiment type: XRAY
Resolution: 2.35 Å
R-factor: 0.19213
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: n-acetylneuraminate lyase
    Species: STAPHYLOCOCCUS AUREUS SUBSP. AUREUS NCTC 8325 [TaxId:93061]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q2G160 (6-297)
      • expression tag (5)
  • Chain 'B':
    Compound: n-acetylneuraminate lyase
    Species: STAPHYLOCOCCUS AUREUS SUBSP. AUREUS NCTC 8325 [TaxId:93061]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q2G160 (6-297)
      • expression tag (4-5)
  • Chain 'C':
    Compound: n-acetylneuraminate lyase
    Species: STAPHYLOCOCCUS AUREUS SUBSP. AUREUS NCTC 8325 [TaxId:93061]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q2G160 (6-297)
      • expression tag (0-5)
    Domains in SCOPe 2.02: d4amac_
  • Chain 'D':
    Compound: n-acetylneuraminate lyase
    Species: STAPHYLOCOCCUS AUREUS SUBSP. AUREUS NCTC 8325 [TaxId:93061]
    Database cross-references and differences (RAF-indexed):
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4amaC (C:)
    hhhhhhnkdlkglyaallvpfdengqvneqglkqiaqnaieteeldglyvngssgenfll
    nteqkkqvfkvakeavgdkvkliaqvgsldlneaielgkyatelgydalsavtpfyypft
    feeirdyyfdiieatqnnmiiyaipdltgvnisieqfselfnhekivgvxytapnfflle
    rirkafpdklilsgfdemlvqatisgvdgaigstynvngrrarkifdlarqgqiqeayql
    qhdsndiietvlsmgiyptlkeilrhrgidaglpkrpfkpfneahrqtldqliakydl
    

  • Chain 'D':
    No sequence available.