PDB entry 4am2

View 4am2 on RCSB PDB site
Description: Bacterioferritin from Blastochloris viridis
Class: metal binding protein
Keywords: metal binding protein, ferroxidase centre, iron storage, di iron centre, iron channel
Deposited on 2012-03-07, released 2012-10-31
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-12-13, with a file datestamp of 2017-12-08.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: N/A
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: bacterioferritin
    Species: Blastochloris viridis [TaxId:1079]
    Database cross-references and differences (RAF-indexed):
    • PDB 4AM2 (0-158)
    Domains in SCOPe 2.07: d4am2a_
  • Chain 'B':
    Compound: bacterioferritin
    Species: Blastochloris viridis [TaxId:1079]
    Database cross-references and differences (RAF-indexed):
    • PDB 4AM2 (0-158)
    Domains in SCOPe 2.07: d4am2b_
  • Heterogens: HEM, FE, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >4am2A (A:)
mkgdqkvieylnrglrseltavsqywlhyrmledwgykdlakkwraesieemahadkfve
rilfleglpnlqtldplrigqtvkevlesdlaaerearalyqegaayaasvgdfpsknlf
eelmgdeehhidfletqldlvsklglelyaqhhigkldd

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >4am2B (B:)
mkgdqkvieylnrglrseltavsqywlhyrmledwgykdlakkwraesieemahadkfve
rilfleglpnlqtldplrigqtvkevlesdlaaerearalyqegaayaasvgdfpsknlf
eelmgdeehhidfletqldlvsklglelyaqhhigkldd