PDB entry 4am1

View 4am1 on RCSB PDB site
Description: Crystal structure of the marine crustacean decapod shrimp (Litopenaeus vannamei) arginine kinase in the absence of substrate or ligands.
Class: transferase
Keywords: transferase
Deposited on 2012-03-07, released 2012-07-11
The last revision prior to the SCOPe 2.06 freeze date was dated 2012-07-18, with a file datestamp of 2012-07-13.
Experiment type: XRAY
Resolution: 1.25 Å
R-factor: 0.1607
AEROSPACI score: 0.79 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: arginine kinase
    Species: LITOPENAEUS VANNAMEI [TaxId:6689]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q004B5 (1-355)
      • expression tag (0)
      • see remark 999 (42)
      • see remark 999 (130)
      • see remark 999 (138)
      • see remark 999 (200)
      • see remark 999 (285)
      • see remark 999 (294)
      • conflict (308)
    Domains in SCOPe 2.06: d4am1a1, d4am1a2, d4am1a3
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4am1A (A:)
    gadaaviekleagfkkleaatdcksllkkyltkevfdklkdkktslgatlldviqsgven
    ldsgvgiyapdaeaytlfaplfdpiiedyhvgfkqtdkhpnkdfgdvnsfvnvdpegkfv
    istrvrcgrsmqgypfnpmltesqykemeakvsstlsslegelkgtyypltgmskevqqk
    liddhflfkegdrflqaanamrywpagrgiyhndnktflvwvneedhlriismqmggdlg
    qvfrrltsavneiekripfshhdrlgfltfcptnlgttvrasvhiilpklaanrakleev
    agkynlqvagtrgehteaeggiydisnkrrmgltefqavkemqdgilelikiekem
    

    Sequence, based on observed residues (ATOM records): (download)
    >4am1A (A:)
    gadaaviekleagfkkleaatdcksllkkyltkevfdklkdkktslgatlldviqsgven
    ldsgvgiyapdaeaytlfaplfdpiiedyhvgfkqtdkhpnkdfgdvnsfvnvdpegkfv
    istrvrcgrsmqgypfnpmltesqykemeakvsstlsslegelkgtyypltgmskevqqk
    liddhflfkegdrflqaanamrywpagrgiyhndnktflvwvneedhlriismqmggdlg
    qvfrrltsavneiekripfshhdrlgfltfcptnlgttvrasvhiilpklaanrakleev
    agkynlqvagiydisnkrrmgltefqavkemqdgilelikiekem