PDB entry 4alu

View 4alu on RCSB PDB site
Description: Benzofuropyrimidinone Inhibitors of Pim-1
Class: transferase
Keywords: proto-oncogene, transferase
Deposited on 2012-03-05, released 2013-01-16
The last revision prior to the SCOPe 2.05 freeze date was dated 2013-01-16, with a file datestamp of 2013-01-11.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.18391
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Serine/threonine-protein kinase pim-1
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot P11309
      • conflict (63)
    Domains in SCOPe 2.05: d4alua_
  • Heterogens: IMD, 79O, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4aluA (A:)
    mhhhhhhgenlyfqgsllskinslahlraapcndlhatklapgkekeplesqyqvgpllg
    sggsgsvysgirvsdnlpvaikhvekdrisdwgelpngtrvpmevvllkkvssgfsgvir
    lldwferpdsfvlilerpepvqdlfdfitergalqeelarsffwqvleavrhchncgvlh
    rdikdenilidlnrgelklidfgsgallkdtvytdfdgtrvysppewiryhryhgrsaav
    wslgillydmvcgdipfehdeeiirgqvffrqrvssecqhlirwclalrpsdrptfeeiq
    nhpwmqdvllpqetaeihlhslspgpsk
    

    Sequence, based on observed residues (ATOM records): (download)
    >4aluA (A:)
    plesqyqvgpllgsggsgsvysgirvsdnlpvaikhvekdrisdwgelpngtrvpmevvl
    lkkvssgfsgvirlldwferpdsfvlilerpepvqdlfdfitergalqeelarsffwqvl
    eavrhchncgvlhrdikdenilidlnrgelklidfgsgallkdtvytdfdgtrvysppew
    iryhryhgrsaavwslgillydmvcgdipfehdeeiirgqvffrqrvssecqhlirwcla
    lrpsdrptfeeiqnhpwmqdvllpqetaeihlhs