PDB entry 4alq

View 4alq on RCSB PDB site
Description: X-Ray photoreduction of Polysaccharide monooxygenase CBM33
Class: chitin-binding protein
Keywords: chitin-binding protein, chitin degradation, microspectrophotometry, x-ray induced photo reduction
Deposited on 2012-03-05, released 2013-02-27
The last revision prior to the SCOPe 2.08 freeze date was dated 2019-05-08, with a file datestamp of 2019-05-03.
Experiment type: XRAY
Resolution: 1.48 Å
R-factor: N/A
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: chitin binding protein
  Species: Enterococcus faecalis [TaxId:226185]
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q838S1 (0-165)
  Domains in SCOPe 2.08: d4alqa_
• Heterogens: CU, PEG, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >4alqA (A:)
  hgyvaspgsraffgssaggnlntnvgraqwepqsieapkntfitgklasagvsgfeplde
  qtatrwhktnittgplditwnltaqhrtaswdyyitkngwnpnqpldiknfdkiasidgk
  qevpnkvvkqtiniptdrkgyhviyavwgigdtvnafyqaidvniq