PDB entry 4al2

View 4al2 on RCSB PDB site
Description: peptide deformylase (Ni-form) with hydrosulfide
Class: hydrolase
Keywords: hydrolase, oxidation-reduction
Deposited on 2012-02-29, released 2012-04-04
The last revision prior to the SCOPe 2.07 freeze date was dated 2012-11-14, with a file datestamp of 2012-11-09.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.2108
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Peptide deformylase
    Species: ESCHERICHIA COLI [TaxId:469008]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4al2a_
  • Chain 'B':
    Compound: Peptide deformylase
    Species: ESCHERICHIA COLI [TaxId:469008]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4al2b_
  • Chain 'C':
    Compound: Peptide deformylase
    Species: ESCHERICHIA COLI [TaxId:469008]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4al2c_
  • Heterogens: NI, H2S, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4al2A (A:)
    svlqvlhipderlrkvakpveevnaeiqrivddmfetmyaeegiglaatqvdihqriivi
    dvsenrderlvlinpelleksgetgieegclsipeqralvpraekvkiraldrdgkpfel
    eadgllaiciqhemdhlvgklfmdylsplkqqrirqkvekldrlkarasssvdklaaale
    hhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4al2A (A:)
    svlqvlhipderlrkvakpveevnaeiqrivddmfetmyaeegiglaatqvdihqriivi
    dvsenrderlvlinpelleksgetgieegclsipeqralvpraekvkiraldrdgkpfel
    eadgllaiciqhemdhlvgklfmdylsplkqqrirqkvekld
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4al2B (B:)
    svlqvlhipderlrkvakpveevnaeiqrivddmfetmyaeegiglaatqvdihqriivi
    dvsenrderlvlinpelleksgetgieegclsipeqralvpraekvkiraldrdgkpfel
    eadgllaiciqhemdhlvgklfmdylsplkqqrirqkvekldrlkarasssvdklaaale
    hhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4al2B (B:)
    svlqvlhipderlrkvakpveevnaeiqrivddmfetmyaeegiglaatqvdihqriivi
    dvsenrderlvlinpelleksgetgieegclsipeqralvpraekvkiraldrdgkpfel
    eadgllaiciqhemdhlvgklfmdylsplkqqrirqkvekldrlkar
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4al2C (C:)
    svlqvlhipderlrkvakpveevnaeiqrivddmfetmyaeegiglaatqvdihqriivi
    dvsenrderlvlinpelleksgetgieegclsipeqralvpraekvkiraldrdgkpfel
    eadgllaiciqhemdhlvgklfmdylsplkqqrirqkvekldrlkarasssvdklaaale
    hhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4al2C (C:)
    svlqvlhipderlrkvakpveevnaeiqrivddmfetmyaeegiglaatqvdihqriivi
    dvsenrderlvlinpelleksgetgieegclsipeqralvpraekvkiraldrdgkpfel
    eadgllaiciqhemdhlvgklfmdylsplkqqrirqkvekld