PDB entry 4akd

View 4akd on RCSB PDB site
Description: High resolution structure of Mannose Binding lectin from Champedak (CMB)
Class: sugar binding protein
Keywords: sugar binding protein
Deposited on 2012-02-22, released 2013-02-27
The last revision prior to the SCOPe 2.07 freeze date was dated 2014-06-18, with a file datestamp of 2014-06-13.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.1956
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: mannose-specific lectin km+
    Species: Artocarpus integer [TaxId:3490]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q7M1T4 (1-149)
      • expression tag (0)
      • see remark 999 (13)
      • see remark 999 (41)
      • see remark 999 (50)
      • see remark 999 (52)
      • see remark 999 (70)
      • see remark 999 (73)
      • see remark 999 (77)
      • see remark 999 (84)
    Domains in SCOPe 2.07: d4akda1, d4akda2
  • Chain 'B':
    Compound: mannose-specific lectin km+
    Species: Artocarpus integer [TaxId:3490]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q7M1T4 (1-149)
      • expression tag (0)
      • see remark 999 (13)
      • see remark 999 (41)
      • see remark 999 (50)
      • see remark 999 (52)
      • see remark 999 (70)
      • see remark 999 (73)
      • see remark 999 (77)
      • see remark 999 (84)
    Domains in SCOPe 2.07: d4akdb1, d4akdb2
  • Chain 'C':
    Compound: mannose-specific lectin km+
    Species: Artocarpus integer [TaxId:3490]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q7M1T4 (1-149)
      • expression tag (0)
      • see remark 999 (13)
      • see remark 999 (41)
      • see remark 999 (50)
      • see remark 999 (52)
      • see remark 999 (70)
      • see remark 999 (73)
      • see remark 999 (77)
    Domains in SCOPe 2.07: d4akdc1, d4akdc2
  • Chain 'D':
    Compound: mannose-specific lectin km+
    Species: Artocarpus integer [TaxId:3490]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q7M1T4 (1-149)
      • expression tag (0)
      • see remark 999 (13)
      • see remark 999 (41)
      • see remark 999 (50)
      • see remark 999 (52)
      • see remark 999 (70)
      • see remark 999 (73)
      • see remark 999 (77)
      • see remark 999 (84)
    Domains in SCOPe 2.07: d4akdd1, d4akdd2
  • Heterogens: CD, CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4akdA (A:)
    masqtitvgpwggsggngwddgsytgirqielsykeaigsfcviydlngesfpgpkhtsk
    lpyknvkielqfpeeflvsvsgytgpfsalatptpvvrsltfktnkgrtfgpygdeegty
    fnlpienglivgfkgrtgdlldaigvhmal
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4akdB (B:)
    masqtitvgpwggsggngwddgsytgirqielsykeaigsfcviydlngesfpgpkhtsk
    lpyknvkielqfpeeflvsvsgytgpfsalatptpvvrsltfktnkgrtfgpygdeegty
    fnlpienglivgfkgrtgdlldaigvhmal
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4akdC (C:)
    masqtitvgpwggsggngwddgsytgirqielsykeaigsfcviydlngesfpgpkhtsk
    lpyknvkielqfpeeflvsvsgytgpfsalatptpvvrsltfktnkgrtfgpygdeegty
    fnlpienglivgfkgrtgdlldaigvhmal
    

    Sequence, based on observed residues (ATOM records): (download)
    >4akdC (C:)
    masqtitvgpwggsggngwddgsytgirqielsykeaigsfcviydlngesfpgpkhtsk
    lpyknvkielqfpeeflvsvsgytatptpvvrsltfktnkgrtfgpygdeegtyfnlpie
    nglivgfkgrtgdlldaigvhmal
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4akdD (D:)
    masqtitvgpwggsggngwddgsytgirqielsykeaigsfcviydlngesfpgpkhtsk
    lpyknvkielqfpeeflvsvsgytgpfsalatptpvvrsltfktnkgrtfgpygdeegty
    fnlpienglivgfkgrtgdlldaigvhmal