PDB entry 4ajf

View 4ajf on RCSB PDB site
Description: Identification and structural characterization of PDE10 fragment inhibitors
Class: hydrolase
Keywords: hydrolase
Deposited on 2012-02-16, released 2013-03-06
The last revision prior to the SCOPe 2.07 freeze date was dated 2013-03-06, with a file datestamp of 2013-03-01.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.2151
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: camp and camp-inhibited cgmp 3', 5'-cyclic phosphodiesterase 10a
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9Y233 (2-327)
      • expression tag (0-1)
    Domains in SCOPe 2.07: d4ajfa1, d4ajfa2
  • Chain 'D':
    Compound: camp and camp-inhibited cgmp 3', 5'-cyclic phosphodiesterase 10a
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9Y233 (2-End)
      • expression tag (0-1)
    Domains in SCOPe 2.07: d4ajfd1, d4ajfd2
  • Heterogens: ZN, MG, F03, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4ajfA (A:)
    nasictseewqglmqftlpvrlckeielfhfdigpfenmwpgifvymvhrscgtscfele
    klcrfimsvkknyrrvpyhnwkhavtvahcmyailqnnhtlftdlerkglliaclchdld
    hrgfsnsylqkfdhplaalyststmeqhhfsqtvsilqleghnifstlssseyeqvleii
    rkaiiatdlalyfgnrkqleemyqtgslnlnnqshrdrviglmmtacdlcsvtklwpvtk
    ltandiyaefwaegdemkklgiqpipmmdrdkkdevpqgqlgfynavaipcyttltqilp
    ptepllkacrdnlsqwekvirgeetatw
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >4ajfD (D:)
    nasictseewqglmqftlpvrlckeielfhfdigpfenmwpgifvymvhrscgtscfele
    klcrfimsvkknyrrvpyhnwkhavtvahcmyailqnnhtlftdlerkglliaclchdld
    hrgfsnsylqkfdhplaalyststmeqhhfsqtvsilqleghnifstlssseyeqvleii
    rkaiiatdlalyfgnrkqleemyqtgslnlnnqshrdrviglmmtacdlcsvtklwpvtk
    ltandiyaefwaegdemkklgiqpipmmdrdkkdevpqgqlgfynavaipcyttltqilp
    ptepllkacrdnlsqwekvirgeetatw
    

    Sequence, based on observed residues (ATOM records): (download)
    >4ajfD (D:)
    nasictseewqglmqftlpvrlckeielfhfdigpfenmwpgifvymvhrscgtscfele
    klcrfimsvkknyrrvpyhnwkhavtvahcmyailqnnhtlftdlerkglliaclchdld
    hrgfsnsylqkfdhplaalyststmeqhhfsqtvsilqleghnifstlssseyeqvleii
    rkaiiatdlalyfgnrkqleemyqtgslnlnnqshrdrviglmmtacdlcsvtklwpvtk
    ltandiyaefwaegdemkklgiqpipmmdrdkkdevpqgqlgfynavaipcyttltqilp
    ptepllkacrdnlsqwekvirgee