PDB entry 4aj8

View 4aj8 on RCSB PDB site
Description: Crystallographic structure of thioredoxin from Litopenaeus vannamei (partially reduced).
Class: oxidoreductase
Keywords: oxidoreductase, disulfide reduction
Deposited on 2012-02-16, released 2013-03-06
The last revision prior to the SCOPe 2.07 freeze date was dated 2013-06-05, with a file datestamp of 2013-05-31.
Experiment type: XRAY
Resolution: 1.54 Å
R-factor: 0.1802
AEROSPACI score: 0.62 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: thioredoxin
    Species: LITOPENAEUS VANNAMEI [TaxId:6689]
    Database cross-references and differences (RAF-indexed):
    • Uniprot B1PWB9 (0-104)
      • conflict (10)
    Domains in SCOPe 2.07: d4aj8a_
  • Chain 'B':
    Compound: thioredoxin
    Species: LITOPENAEUS VANNAMEI [TaxId:6689]
    Database cross-references and differences (RAF-indexed):
    • Uniprot B1PWB9 (0-104)
      • conflict (10)
    Domains in SCOPe 2.07: d4aj8b_
  • Heterogens: GOL, ACT, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4aj8A (A:)
    mvyqvkdqedftkqlneagnklvvidfyatwcgpckmiapkleelsqsmsdvvflkvdvd
    ecediaqdnqiacmptflfmkngqkldslsganydkllelveknk
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4aj8B (B:)
    mvyqvkdqedftkqlneagnklvvidfyatwcgpckmiapkleelsqsmsdvvflkvdvd
    ecediaqdnqiacmptflfmkngqkldslsganydkllelveknk