PDB entry 4aiv

View 4aiv on RCSB PDB site
Description: Crystal Structure of putative NADH-dependent nitrite reductase small subunit from Mycobacterium tuberculosis
Class: oxidoreductase
Keywords: oxidoreductase, nitrite metabolism
Deposited on 2012-02-15, released 2012-09-12
The last revision prior to the SCOPe 2.06 freeze date was dated 2012-11-14, with a file datestamp of 2012-11-09.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.1967
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: probable nitrite reductase [nad(p)h] small subunit nird
    Species: Mycobacterium tuberculosis [TaxId:83332]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4aiva_
  • Heterogens: GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4aivA (A:)
    mtllndiqvwttacaydhlipgrgvgvllddgsqvalfrlddgsvhavgnvdpfsgaavm
    srgivgdrggramvqspilkqafalddgsclddprvsvpvyparvtpegriqvarvavg
    

    Sequence, based on observed residues (ATOM records): (download)
    >4aivA (A:)
    diqvwttacaydhlipgrgvgvllddgsqvalfrlddgsvhavgnvdpfsgaavmsrgiv
    gdrggramvqspilkqafalddgsclddprvsvpvyparvtpegriqvarvav