PDB entry 4aih

View 4aih on RCSB PDB site
Description: Crystal structure of RovA from Yersinia in its free form
Class: transcription
Keywords: transcription, transcription factor, global regulator, virulence regulation, thermosensing
Deposited on 2012-02-09, released 2012-09-12
The last revision prior to the SCOPe 2.08 freeze date was dated 2012-11-14, with a file datestamp of 2012-11-09.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.22262
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Transcriptional regulator slyA
    Species: Yersinia pseudotuberculosis [TaxId:502800]
    Database cross-references and differences (RAF-indexed):
    • Uniprot B1JJ73 (Start-142)
      • engineered mutation (80)
      • engineered mutation (107)
    Domains in SCOPe 2.08: d4aiha_
  • Chain 'B':
    Compound: Transcriptional regulator slyA
    Species: Yersinia pseudotuberculosis [TaxId:502800]
    Database cross-references and differences (RAF-indexed):
    • Uniprot B1JJ73
      • engineered mutation (107)
    Domains in SCOPe 2.08: d4aihb_
  • Chain 'C':
    Compound: Transcriptional regulator slyA
    Species: Yersinia pseudotuberculosis [TaxId:502800]
    Database cross-references and differences (RAF-indexed):
    • Uniprot B1JJ73 (Start-142)
      • engineered mutation (107)
    Domains in SCOPe 2.08: d4aihc_
  • Chain 'D':
    Compound: Transcriptional regulator slyA
    Species: Yersinia pseudotuberculosis [TaxId:502800]
    Database cross-references and differences (RAF-indexed):
    • Uniprot B1JJ73 (Start-142)
      • engineered mutation (107)
    Domains in SCOPe 2.08: d4aihd_
  • Chain 'E':
    Compound: Transcriptional regulator slyA
    Species: Yersinia pseudotuberculosis [TaxId:502800]
    Database cross-references and differences (RAF-indexed):
    • Uniprot B1JJ73
      • engineered mutation (107)
    Domains in SCOPe 2.08: d4aihe_
  • Chain 'F':
    Compound: Transcriptional regulator slyA
    Species: Yersinia pseudotuberculosis [TaxId:502800]
    Database cross-references and differences (RAF-indexed):
    • Uniprot B1JJ73
      • engineered mutation (107)
    Domains in SCOPe 2.08: d4aihf_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4aihA (A:)
    mestlgsdlarlvrvwralidhrlkpleltqthwvtlyninrlppeqsqiqlakaigieq
    pslvrtldqleekglitrhtsandrrakriklteqsspiieqvdgvisstrkeilggiss
    deiavlsglidklekniiqlqtklehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4aihA (A:)
    estlgsdlarlvrvwralidhrlkpleltqthwvtlyninrlppeqsqiqlakaigieqp
    slvrtldqleekglitrhtsanakriklteqsspiieqvdgvisstrkeilggissdeia
    vlsglidklekniiqlqtk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4aihB (B:)
    mestlgsdlarlvrvwralidhrlkpleltqthwvtlyninrlppeqsqiqlakaigieq
    pslvrtldqleekglitrhtsandrrakriklteqsspiieqvdgvisstrkeilggiss
    deiavlsglidklekniiqlqtklehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4aihB (B:)
    estlgsdlarlvrvwralidhrlkpleltqthwvtlyninrlppeqsqiqlakaigieqp
    slvrtldqleekglitrhtakriklteqsspiieqvdgvisstrkeilggissdeiavls
    glidklekniiqlqt
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4aihC (C:)
    mestlgsdlarlvrvwralidhrlkpleltqthwvtlyninrlppeqsqiqlakaigieq
    pslvrtldqleekglitrhtsandrrakriklteqsspiieqvdgvisstrkeilggiss
    deiavlsglidklekniiqlqtklehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4aihC (C:)
    stlgsdlarlvrvwralidhrlkpleltqthwvtlyninrlppeqsqiqlakaigieqps
    lvrtldqleekglitrriklteqsspiieqvdgvisstrkeilggissdeiavlsglidk
    lekniiqlqtk
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >4aihD (D:)
    mestlgsdlarlvrvwralidhrlkpleltqthwvtlyninrlppeqsqiqlakaigieq
    pslvrtldqleekglitrhtsandrrakriklteqsspiieqvdgvisstrkeilggiss
    deiavlsglidklekniiqlqtklehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4aihD (D:)
    stlgsdlarlvrvwralidhrlkpleltqthwvtlyninrlppeqsqiqlakaigieqps
    lvrtldqleekglitrhkriklteqsspiieqvdgvisstrkeilggissdeiavlsgli
    dklekniiqlqtk
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >4aihE (E:)
    mestlgsdlarlvrvwralidhrlkpleltqthwvtlyninrlppeqsqiqlakaigieq
    pslvrtldqleekglitrhtsandrrakriklteqsspiieqvdgvisstrkeilggiss
    deiavlsglidklekniiqlqtklehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4aihE (E:)
    stlgsdlarlvrvwralidhrlkpleltqthwvtlyninrlppeqsqiqlakaigieqps
    lvrtldqleekglitrhtkriklteqsspiieqvdgvisstrkeilggissdeiavlsgl
    idklekniiqlq
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >4aihF (F:)
    mestlgsdlarlvrvwralidhrlkpleltqthwvtlyninrlppeqsqiqlakaigieq
    pslvrtldqleekglitrhtsandrrakriklteqsspiieqvdgvisstrkeilggiss
    deiavlsglidklekniiqlqtklehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4aihF (F:)
    stlgsdlarlvrvwralidhrlkpleltqthwvtlyninrlpplakaigieqpslvrtld
    qleekgeqsspiieqvdgvisstrkeilggissdeiavlsglidklekniiqlqt