PDB entry 4ai4

View 4ai4 on RCSB PDB site
Description: crystal structure of E38Q mutant of 3-methyladenine DNA glycosylase I from Staphylococcus aureus
Class: hydrolase
Keywords: hydrolase, DNA repair
Deposited on 2012-02-08, released 2012-02-15
The last revision prior to the SCOPe 2.07 freeze date was dated 2012-06-20, with a file datestamp of 2012-06-15.
Experiment type: XRAY
Resolution: 1.73 Å
R-factor: 0.17485
AEROSPACI score: 0.56 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: DNA-3-methyladenine glycosylase I
    Species: STAPHYLOCOCCUS AUREUS SUBSP. AUREUS MSSA476 [TaxId:282459]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q6G8R1 (2-187)
      • engineered mutation (39)
    Domains in SCOPe 2.07: d4ai4a_
  • Heterogens: ZN, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4ai4A (A:)
    gamnecafgtkdpvylnyhdhvwgqplydskalfkllalqsqhaglswltilkkkeayee
    afydfepekvaqmtaqdidrlmtfpnivhhrkkleaivnqaqgylkieqaygsfskflws
    yvngkpkdlqyehasdritvddtatqlskdlkqygfkflgpvtvfsfleaaglydahlkd
    cpskpkhn
    

    Sequence, based on observed residues (ATOM records): (download)
    >4ai4A (A:)
    mnecafgtkdpvylnyhdhvwgqplydskalfkllalqsqhaglswltilkkkeayeeaf
    ydfepekvaqmtaqdidrlmtfpnivhhrkkleaivnqaqgylkieqaygsfskflwsyv
    ngkpkdlqyehasdritvddtatqlskdlkqygfkflgpvtvfsfleaaglydahlkdcp
    skpkhn