PDB entry 4ahw

View 4ahw on RCSB PDB site
Description: Flo5A showing a heptanuclear gadolinium cluster on its surface
Class: sugar binding protein
Keywords: sugar binding protein, adhesin, flocculin
Deposited on 2012-02-07, released 2012-10-03
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-06-28, with a file datestamp of 2017-06-23.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: N/A
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: flocculation protein flo5
    Species: Saccharomyces cerevisiae [TaxId:559292]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P38894 (21-269)
      • expression tag (12-20)
    Domains in SCOPe 2.07: d4ahwa1, d4ahwa2
  • Heterogens: GD, CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4ahwA (A:)
    mgsshhhhhhssglvprgshmsgateaclpagqrksgmninfyqyslkdsstysnaayma
    ygyasktklgsvggqtdisidynipcvsssgtfpcpqedsygnwgckgmgacsnsqgiay
    wstdlfgfyttptnvtlemtgyflppqtgsytfsfatvddsailsvggsiafeccaqeqp
    pitstnftingikpwdgslpdnitgtvymyagyyyplkvvysnavswgtlpisvelpdgt
    tvsdnfegyvysfdddlsqsnctipdpsih
    

    Sequence, based on observed residues (ATOM records): (download)
    >4ahwA (A:)
    glvprgshmsgateaclpagqrksgmninfyqyslkdsstysnaaymaygyasktklgsv
    ggqtdisidynipcvsssgtfpcpqedsygnwgckgmgacsnsqgiaywstdlfgfyttp
    tnvtlemtgyflppqtgsytfsfatvddsailsvggsiafeccaqeqppitstnftingi
    kpwdgslpdnitgtvymyagyyyplkvvysnavswgtlpisvelpdgttvsdnfegyvys
    fdddlsqsnctipdpsih