PDB entry 4aho

View 4aho on RCSB PDB site
Description: Crystal Structure of N-acetylneuraminic acid lyase from Staphylococcus aureus with the chemical modification thia-lysine at position 165
Class: lyase
Keywords: lyase
Deposited on 2012-02-06, released 2013-01-23
The last revision prior to the SCOPe 2.03 freeze date was dated 2013-03-13, with a file datestamp of 2013-03-08.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.19773
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: n-acetylneuraminate lyase
    Species: STAPHYLOCOCCUS AUREUS SUBSP. AUREUS NCTC 8325 [TaxId:93061]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d4ahoa_
  • Chain 'B':
    Compound: n-acetylneuraminate lyase
    Species: STAPHYLOCOCCUS AUREUS SUBSP. AUREUS NCTC 8325 [TaxId:93061]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d4ahob_
  • Chain 'C':
    Compound: n-acetylneuraminate lyase
    Species: STAPHYLOCOCCUS AUREUS SUBSP. AUREUS NCTC 8325 [TaxId:93061]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d4ahoc_
  • Chain 'D':
    Compound: n-acetylneuraminate lyase
    Species: STAPHYLOCOCCUS AUREUS SUBSP. AUREUS NCTC 8325 [TaxId:93061]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d4ahod_
  • Heterogens: CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4ahoA (A:)
    hhhhhhmnkdlkglyaallvpfdengqvneqglkqiaqnaieteeldglyvngssgenfl
    lnteqkkqvfkvakeavgdkvkliaqvgsldlneaielgkyatelgydalsavtpfyypf
    tfeeirdyyfdiieatqnnmiiyaipdltgvnisieqfselfnhekivgvkytapnffll
    erirkafpdklilsgfdemlvqatisgvdgaigstynvngrrarkifdlarqgqiqeayq
    lqhdsndiietvlsmgiyptlkeilrhrgidaglpkrpfkpfneahrqtldqliakydl
    

    Sequence, based on observed residues (ATOM records): (download)
    >4ahoA (A:)
    nkdlkglyaallvpfdengqvneqglkqiaqnaieteeldglyvngssgenfllnteqkk
    qvfkvakeavgdkvkliaqvgsldlneaielgkyatelgydalsavtpfyypftfeeird
    yyfdiieatqnnmiiyisieqfselfnhekivgvkytapnffllerirkafpdklilsgf
    demlvqatisgvdgaigstynvngrrarkifdlarqgqiqeayqlqhdsndiietvlsmg
    iyptlkeilrhrgidaglpkrpfkpfneahrqtldqliakydl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4ahoB (B:)
    hhhhhhmnkdlkglyaallvpfdengqvneqglkqiaqnaieteeldglyvngssgenfl
    lnteqkkqvfkvakeavgdkvkliaqvgsldlneaielgkyatelgydalsavtpfyypf
    tfeeirdyyfdiieatqnnmiiyaipdltgvnisieqfselfnhekivgvkytapnffll
    erirkafpdklilsgfdemlvqatisgvdgaigstynvngrrarkifdlarqgqiqeayq
    lqhdsndiietvlsmgiyptlkeilrhrgidaglpkrpfkpfneahrqtldqliakydl
    

    Sequence, based on observed residues (ATOM records): (download)
    >4ahoB (B:)
    mnkdlkglyaallvpfdengqvneqglkqiaqnaieteeldglyvngssgenfllnteqk
    kqvfkvakeavgdkvkliaqvgsldlneaielgkyatelgydalsavtpfyypftfeeir
    dyyfdiieatqnnmiiyisieqfselfnhekivgvkytapnffllerirkafpdklilsg
    fdemlvqatisgvdgaigstynvngrrarkifdlarqgqiqeayqlqhdsndiietvlsm
    giyptlkeilrhrgidaglpkrpfkpfneahrqtldqliakydl
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4ahoC (C:)
    hhhhhhmnkdlkglyaallvpfdengqvneqglkqiaqnaieteeldglyvngssgenfl
    lnteqkkqvfkvakeavgdkvkliaqvgsldlneaielgkyatelgydalsavtpfyypf
    tfeeirdyyfdiieatqnnmiiyaipdltgvnisieqfselfnhekivgvkytapnffll
    erirkafpdklilsgfdemlvqatisgvdgaigstynvngrrarkifdlarqgqiqeayq
    lqhdsndiietvlsmgiyptlkeilrhrgidaglpkrpfkpfneahrqtldqliakydl
    

    Sequence, based on observed residues (ATOM records): (download)
    >4ahoC (C:)
    nkdlkglyaallvpfdengqvneqglkqiaqnaieteeldglyvngssgenfllnteqkk
    qvfkvakeavgdkvkliaqvgsldlneaielgkyatelgydalsavtpfyypftfeeird
    yyfdiieatqnnmiiyisieqfselfnhekivgvkytapnffllerirkafpdklilsgf
    demlvqatisgvdgaigstynvngrrarkifdlarqgqiqeayqlqhdsndiietvlsmg
    iyptlkeilrhrgidaglpkrpfkpfneahrqtldqliakydl
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >4ahoD (D:)
    hhhhhhmnkdlkglyaallvpfdengqvneqglkqiaqnaieteeldglyvngssgenfl
    lnteqkkqvfkvakeavgdkvkliaqvgsldlneaielgkyatelgydalsavtpfyypf
    tfeeirdyyfdiieatqnnmiiyaipdltgvnisieqfselfnhekivgvkytapnffll
    erirkafpdklilsgfdemlvqatisgvdgaigstynvngrrarkifdlarqgqiqeayq
    lqhdsndiietvlsmgiyptlkeilrhrgidaglpkrpfkpfneahrqtldqliakydl
    

    Sequence, based on observed residues (ATOM records): (download)
    >4ahoD (D:)
    kdlkglyaallvpfdengqvneqglkqiaqnaieteeldglyvngssgenfllnteqkkq
    vfkvakeavgdkvkliaqvgsldlneaielgkyatelgydalsavtpfyypftfeeirdy
    yfdiieatqnnmiiysieqfselfnhekivgvkytapnffllerirkafpdklilsgfde
    mlvqatisgvdgaigstynvngrrarkifdlarqgqiqeayqlqhdsndiietvlsmgiy
    ptlkeilrhrgidaglpkrpfkpfneahrqtldqliakydl