PDB entry 4ahi

View 4ahi on RCSB PDB site
Description: K40I - Angiogenin mutants and amyotrophic lateral sclerosis - a biochemical and biological analysis
Class: hydrolase
Keywords: hydrolase, amyotrophic, lateral sclerosis, neovascularisation
Deposited on 2012-02-06, released 2012-10-10
The last revision prior to the SCOPe 2.07 freeze date was dated 2012-10-24, with a file datestamp of 2012-10-19.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.2163
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: angiogenin
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P03950
      • engineered mutation (39)
    Domains in SCOPe 2.07: d4ahia_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4ahiA (A:)
    qdnsrythfltqhydakpqgrddrycesimrrrgltspcidintfihgnkrsikaicenk
    ngnphrenlriskssfqvttcklhggspwppcqyratagfrnvvvacenglpvhldqsif
    rrp
    

    Sequence, based on observed residues (ATOM records): (download)
    >4ahiA (A:)
    srythfltqhydakpqgrddrycesimrrrgltspcidintfihgnkrsikaicenkngn
    phrenlriskssfqvttcklhggspwppcqyratagfrnvvvacenglpvhldqsifr