PDB entry 4ahg

View 4ahg on RCSB PDB site
Description: S28N - Angiogenin mutants and amyotrophic lateral sclerosis - a biochemical and biological analysis
Class: hydrolase
Keywords: hydrolase, amyotrophic, lateral sclerosis, neovascularisation
Deposited on 2012-02-06, released 2012-10-10
The last revision prior to the SCOPe 2.07 freeze date was dated 2012-10-10, with a file datestamp of 2012-10-05.
Experiment type: XRAY
Resolution: 2.45 Å
R-factor: 0.2363
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: angiogenin
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P03950
      • engineered mutation (27)
    Domains in SCOPe 2.07: d4ahga_
  • Heterogens: TAR, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4ahgA (A:)
    qdnsrythfltqhydakpqgrddrycenimrrrgltspckdintfihgnkrsikaicenk
    ngnphrenlriskssfqvttcklhggspwppcqyratagfrnvvvacenglpvhldqsif
    rrp
    

    Sequence, based on observed residues (ATOM records): (download)
    >4ahgA (A:)
    dnsrythfltqhydakpqgrddrcenimrrrgltspckdintfihgnkrsikaicenkng
    nphrenlriskssfqvttcklhggspwppcqyratagfrnvvvacenglpvhldqsifrr