PDB entry 4ah3

View 4ah3 on RCSB PDB site
Description: Crystal structure of the holo omega-transaminase from Chromobacterium violaceum
Class: transferase
Keywords: transferase, aminotransferase
Deposited on 2012-02-03, released 2012-02-15
The last revision prior to the SCOPe 2.05 freeze date was dated 2013-04-03, with a file datestamp of 2013-03-29.
Experiment type: XRAY
Resolution: 1.57 Å
R-factor: 0.225
AEROSPACI score: 0.55 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: omega-transaminase
    Species: CHROMOBACTERIUM VIOLACEUM [TaxId:536]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d4ah3a_
  • Chain 'B':
    Compound: omega-transaminase
    Species: CHROMOBACTERIUM VIOLACEUM [TaxId:536]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d4ah3b_
  • Chain 'C':
    Compound: omega-transaminase
    Species: CHROMOBACTERIUM VIOLACEUM [TaxId:536]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d4ah3c_
  • Chain 'D':
    Compound: omega-transaminase
    Species: CHROMOBACTERIUM VIOLACEUM [TaxId:536]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d4ah3d_
  • Heterogens: PLP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4ah3A (A:)
    mqkqrttsqwreldaahhlhpftdtaslnqagarvmtrgegvylwdsegnkiidgmaglw
    cvnvgygrkdfaeaarrqmeelpfyntffktthpavvelssllaevtpagfdrvfytnsg
    sesvdtmirmvrrywdvqgkpekktligrwngyhgstiggaslggmkymheqgdlpipgm
    ahieqpwwykhgkdmtpdefgvvaarwleekileigadkvaafvgepiqgaggvivppat
    ywpeiericrkydvllvadevicgfgrtgewfghqhfgfqpdlftaakglssgylpigav
    fvgkrvaegliaggdfnhgftysghpvcaavahanvaalrdegivqrvkddigpymqkrw
    retfsrfehvddvrgvgmvqaftlvknkakrelfpdfgeigtlcrdiffrnnlimracgd
    hivsapplvmtraevdemlavaercleefeqtlkargla
    

    Sequence, based on observed residues (ATOM records): (download)
    >4ah3A (A:)
    rttsqwreldaahhlhpftdtaslnqagarvmtrgegvylwdsegnkiidgmaglwcvnv
    gygrkdfaeaarrqmeelpfyntffktthpavvelssllaevtpagfdrvfytnsgsesv
    dtmirmvrrywdvqgkpekktligrwngyhgstiggaslggmkymheqgdlpipgmahie
    qpwwykhgkdmtpdefgvvaarwleekileigadkvaafvgepiqgaggvivppatywpe
    iericrkydvllvadevicgfgrtgewfghqhfgfqpdlftaakglssgylpigavfvgk
    rvaegliaggdfnhgftysghpvcaavahanvaalrdegivqrvkddigpymqkrwretf
    srfehvddvrgvgmvqaftlvknkakrelfpdfgeigtlcrdiffrnnlimracgdhivs
    applvmtraevdemlavaercleefeqtlkargla
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4ah3B (B:)
    mqkqrttsqwreldaahhlhpftdtaslnqagarvmtrgegvylwdsegnkiidgmaglw
    cvnvgygrkdfaeaarrqmeelpfyntffktthpavvelssllaevtpagfdrvfytnsg
    sesvdtmirmvrrywdvqgkpekktligrwngyhgstiggaslggmkymheqgdlpipgm
    ahieqpwwykhgkdmtpdefgvvaarwleekileigadkvaafvgepiqgaggvivppat
    ywpeiericrkydvllvadevicgfgrtgewfghqhfgfqpdlftaakglssgylpigav
    fvgkrvaegliaggdfnhgftysghpvcaavahanvaalrdegivqrvkddigpymqkrw
    retfsrfehvddvrgvgmvqaftlvknkakrelfpdfgeigtlcrdiffrnnlimracgd
    hivsapplvmtraevdemlavaercleefeqtlkargla
    

    Sequence, based on observed residues (ATOM records): (download)
    >4ah3B (B:)
    rttsqwreldaahhlhpftdtaslnqagarvmtrgegvylwdsegnkiidgmaglwcvnv
    gygrkdfaeaarrqmeelpfyntffktthpavvelssllaevtpagfdrvfytnsgsesv
    dtmirmvrrywdvqgkpekktligrwngyhgstiggaslggmkymheqgdlpipgmahie
    qpwwykhgkdmtpdefgvvaarwleekileigadkvaafvgepiqgaggvivppatywpe
    iericrkydvllvadevicgfgrtgewfghqhfgfqpdlftaakglssgylpigavfvgk
    rvaegliaggdfnhgftysghpvcaavahanvaalrdegivqrvkddigpymqkrwretf
    srfehvddvrgvgmvqaftlvknkakrelfpdfgeigtlcrdiffrnnlimracgdhivs
    applvmtraevdemlavaercleefeqtlkargla
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4ah3C (C:)
    mqkqrttsqwreldaahhlhpftdtaslnqagarvmtrgegvylwdsegnkiidgmaglw
    cvnvgygrkdfaeaarrqmeelpfyntffktthpavvelssllaevtpagfdrvfytnsg
    sesvdtmirmvrrywdvqgkpekktligrwngyhgstiggaslggmkymheqgdlpipgm
    ahieqpwwykhgkdmtpdefgvvaarwleekileigadkvaafvgepiqgaggvivppat
    ywpeiericrkydvllvadevicgfgrtgewfghqhfgfqpdlftaakglssgylpigav
    fvgkrvaegliaggdfnhgftysghpvcaavahanvaalrdegivqrvkddigpymqkrw
    retfsrfehvddvrgvgmvqaftlvknkakrelfpdfgeigtlcrdiffrnnlimracgd
    hivsapplvmtraevdemlavaercleefeqtlkargla
    

    Sequence, based on observed residues (ATOM records): (download)
    >4ah3C (C:)
    rttsqwreldaahhlhpftdtaslnqagarvmtrgegvylwdsegnkiidgmaglwcvnv
    gygrkdfaeaarrqmeelpfyntffktthpavvelssllaevtpagfdrvfytnsgsesv
    dtmirmvrrywdvqgkpekktligrwngyhgstiggaslggmkymheqgdlpipgmahie
    qpwwykhgkdmtpdefgvvaarwleekileigadkvaafvgepiqgaggvivppatywpe
    iericrkydvllvadevicgfgrtgewfghqhfgfqpdlftaakglssgylpigavfvgk
    rvaegliaggdfnhgftysghpvcaavahanvaalrdegivqrvkddigpymqkrwretf
    srfehvddvrgvgmvqaftlvknkakrelfpdfgeigtlcrdiffrnnlimracgdhivs
    applvmtraevdemlavaercleefeqtlkargla
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >4ah3D (D:)
    mqkqrttsqwreldaahhlhpftdtaslnqagarvmtrgegvylwdsegnkiidgmaglw
    cvnvgygrkdfaeaarrqmeelpfyntffktthpavvelssllaevtpagfdrvfytnsg
    sesvdtmirmvrrywdvqgkpekktligrwngyhgstiggaslggmkymheqgdlpipgm
    ahieqpwwykhgkdmtpdefgvvaarwleekileigadkvaafvgepiqgaggvivppat
    ywpeiericrkydvllvadevicgfgrtgewfghqhfgfqpdlftaakglssgylpigav
    fvgkrvaegliaggdfnhgftysghpvcaavahanvaalrdegivqrvkddigpymqkrw
    retfsrfehvddvrgvgmvqaftlvknkakrelfpdfgeigtlcrdiffrnnlimracgd
    hivsapplvmtraevdemlavaercleefeqtlkargla
    

    Sequence, based on observed residues (ATOM records): (download)
    >4ah3D (D:)
    rttsqwreldaahhlhpftdtaslnqagarvmtrgegvylwdsegnkiidgmaglwcvnv
    gygrkdfaeaarrqmeelpfyntffktthpavvelssllaevtpagfdrvfytnsgsesv
    dtmirmvrrywdvqgkpekktligrwngyhgstiggaslggmkymheqgdlpipgmahie
    qpwwykhgkdmtpdefgvvaarwleekileigadkvaafvgepiqgaggvivppatywpe
    iericrkydvllvadevicgfgrtgewfghqhfgfqpdlftaakglssgylpigavfvgk
    rvaegliaggdfnhgftysghpvcaavahanvaalrdegivqrvkddigpymqkrwretf
    srfehvddvrgvgmvqaftlvknkakrelfpdfgeigtlcrdiffrnnlimracgdhivs
    applvmtraevdemlavaercleefeqtlkargl