PDB entry 4agd

View 4agd on RCSB PDB site
Description: CRYSTAL STRUCTURE OF VEGFR2 (JUXTAMEMBRANE AND KINASE DOMAINS) IN COMPLEX WITH SUNITINIB (SU11248) (N-2-diethylaminoethyl)-5-((Z)-(5- fluoro-2-oxo-1H-indol-3-ylidene)methyl)-2,4-dimethyl-1H-pyrrole-3- carboxamide)
Class: transferase
Keywords: transferase, angiogenesis, nucleotide-binding, inhibitor, phosphorylation, transmembrane
Deposited on 2012-01-26, released 2012-09-26
The last revision prior to the SCOPe 2.05 freeze date was dated 2012-11-14, with a file datestamp of 2012-11-09.
Experiment type: XRAY
Resolution: 2.81 Å
R-factor: 0.21
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Vascular endothelial growth factor receptor 2
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d4agda_
  • Heterogens: B49, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4agdA (A:)
    mgghhhhhhglevlfqgprtvkranggelktgylsivmdpdelpldehcerlpydaskwe
    fprdrlklgkplgrgafgqvieadafgidktatcrtvavkmlkegathsehralmselki
    lihighhlnvvnllgactkpggplmvivefckfgnlstylrskrnefvpykvapedlykd
    fltlehlicysfqvakgmeflasrkcihrdlaarnillseknvvkicdfglardiykdpd
    yvrkgdarlplkwmapetifdrvytiqsdvwsfgvllweifslgaspypgvkideefcrr
    lkegtrmrapdyttpemyqtmldcwhgepsqrptfselvehlgnllqanaqqd
    

    Sequence, based on observed residues (ATOM records): (download)
    >4agdA (A:)
    lsivmdpdelplpydaskwefprdrlklgkplgrgafgqvieadafgidktatcrtvavk
    mlkegathsehralmselkilihighhlnvvnllgactkpggplmvivefckfgnlstyl
    rskrnefvpyykdfltlehlicysfqvakgmeflasrkcihrdlaarnillseknvvkic
    dfglardiykdpdyvrkgdarlplkwmapetifdrvytiqsdvwsfgvllweifslgasp
    ypgvkideefcrrlkegtrmrapdyttpemyqtmldcwhgepsqrptfselvehlgnllq
    anaq