PDB entry 4agc

View 4agc on RCSB PDB site
Description: CRYSTAL STRUCTURE OF VEGFR2 (JUXTAMEMBRANE AND KINASE DOMAINS) IN COMPLEX WITH AXITINIB (AG-013736) (N-Methyl-2-(3-((E)-2-pyridin-2-yl- vinyl)-1H-indazol-6-ylsulfanyl)-benzamide)
Class: transferase
Keywords: transferase, angiogenesis, nucleotide-binding, inhibitor, phosphorylation, transmembrane
Deposited on 2012-01-26, released 2012-09-26
The last revision prior to the SCOPe 2.05 freeze date was dated 2012-11-14, with a file datestamp of 2012-11-09.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.204
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Vascular endothelial growth factor receptor 2
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d4agca_
  • Heterogens: AXI, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4agcA (A:)
    mgghhhhhhglevlfqgprtvkranggelktgylsivmdpdelpldehcerlpydaskwe
    fprdrlklgkplgrgafgqvieadafgidktatcrtvavkmlkegathsehralmselki
    lihighhlnvvnllgactkpggplmvivefckfgnlstylrskrnefvpykvapedlykd
    fltlehlicysfqvakgmeflasrkcihrdlaarnillseknvvkicdfglardiykdpd
    yvrkgdarlplkwmapetifdrvytiqsdvwsfgvllweifslgaspypgvkideefcrr
    lkegtrmrapdyttpemyqtmldcwhgepsqrptfselvehlgnllqanaqqd
    

    Sequence, based on observed residues (ATOM records): (download)
    >4agcA (A:)
    ylsivmdpdelplpydaskwefprdrlklgkplgrgafgqvieadafgidktatcrtvav
    kmlkegathsehralmselkilihighhlnvvnllgactkpggplmvivefckfgnlsty
    lrskrnefvpyykdfltlehlicysfqvakgmeflasrkcihrdlaarnillseknvvki
    cdfglardiykdpdyvrkgdarlplkwmapetifdrvytiqsdvwsfgvllweifslgas
    pypgvkideefcrrlkegtrmrapdyttpemyqtmldcwhgepsqrptfselvehlgnll
    qanaq