PDB entry 4afj

View 4afj on RCSB PDB site
Description: 5-aryl-4-carboxamide-1,3-oxazoles: potent and selective GSK-3 inhibitors
Class: transferase/peptide
Keywords: transferase-peptide complex, kinase
Deposited on 2012-01-19, released 2012-02-29
The last revision prior to the SCOPe 2.06 freeze date was dated 2012-03-07, with a file datestamp of 2012-03-02.
Experiment type: XRAY
Resolution: 1.98 Å
R-factor: 0.1793
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Glycogen synthase kinase-3 beta
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4afja_
  • Chain 'B':
    Compound: Glycogen synthase kinase-3 beta
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4afjb_
  • Chain 'X':
    Compound: proto-oncogene frat1
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed):
  • Chain 'Y':
    Compound: proto-oncogene frat1
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed):
  • Heterogens: SO4, GOL, SJJ, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4afjA (A:)
    kvsrdkdgskvttvvatpgqgpdrpqevsytdtkvigngsfgvvyqaklcdsgelvaikk
    vlqdkrfknrelqimrkldhcnivrlryffyssgekkdevylnlvldyvpetvyrvarhy
    srakqtlpviyvklymyqlfrslayihsfgichrdikpqnllldpdtavlklcdfgsakq
    lvrgepnvsyicsryyrapelifgatdytssidvwsagcvlaelllgqpifpgdsgvdql
    veiikvlgtptreqiremnpnytefkfpqikahpwtkvfrprtppeaialcsrlleytpt
    arltpleacahsffdelrdpnvklpngrdtpalfnfttqelssnpplatilipphariqa
    aastptn
    

    Sequence, based on observed residues (ATOM records): (download)
    >4afjA (A:)
    kvttvvatpgqgpdrpqevsytdtkvigngsfgvvyqaklcdsgelvaikkvlqfknrel
    qimrkldhcnivrlryffysskkdevylnlvldyvpetvyrvarhysrakqtlpviyvkl
    ymyqlfrslayihsfgichrdikpqnllldpdtavlklcdfgsakqlvrgepnvsyicsr
    yyrapelifgatdytssidvwsagcvlaelllgqpifpgdsgvdqlveiikvlgtptreq
    iremnpnytefkfpqikahpwtkvfrprtppeaialcsrlleytptarltpleacahsff
    delrdpnvklpngrdtpalfnfttqelssnpplatilipphari
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4afjB (B:)
    kvsrdkdgskvttvvatpgqgpdrpqevsytdtkvigngsfgvvyqaklcdsgelvaikk
    vlqdkrfknrelqimrkldhcnivrlryffyssgekkdevylnlvldyvpetvyrvarhy
    srakqtlpviyvklymyqlfrslayihsfgichrdikpqnllldpdtavlklcdfgsakq
    lvrgepnvsyicsryyrapelifgatdytssidvwsagcvlaelllgqpifpgdsgvdql
    veiikvlgtptreqiremnpnytefkfpqikahpwtkvfrprtppeaialcsrlleytpt
    arltpleacahsffdelrdpnvklpngrdtpalfnfttqelssnpplatilipphariqa
    aastptn
    

    Sequence, based on observed residues (ATOM records): (download)
    >4afjB (B:)
    gskvttvvatpgqgpdrpqevsytdtkvigngsfgvvyqaklcdsgelvaikkvlqknre
    lqimrkldhcnivrlryffyssgekkdevylnlvldyvpetvyrvarhysrakqtlpviy
    vklymyqlfrslayihsfgichrdikpqnllldpdtavlklcdfgsakqlvrgepnvsyi
    csryyrapelifgatdytssidvwsagcvlaelllgqpifpgdsgvdqlveiikvlgtpt
    reqiremnpnytefkfpqikahpwtkvfrprtppeaialcsrlleytptarltpleacah
    sffdelrdpnvklpngrdtpalfnfttqelssnpplatilipphari
    

  • Chain 'X':
    No sequence available.

  • Chain 'Y':
    No sequence available.