PDB entry 4afe

View 4afe on RCSB PDB site
Description: Nek2 bound to hybrid compound 21
Class: transferase
Keywords: transferase, mitosis
Deposited on 2012-01-19, released 2012-04-25
The last revision prior to the SCOPe 2.05 freeze date was dated 2012-04-25, with a file datestamp of 2012-04-20.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.2183
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: serine/threonine-protein kinase nek2
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot P51955 (Start-270)
      • expression tag (271-278)
    Domains in SCOPe 2.05: d4afea_
  • Heterogens: GGY, EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4afeA (A:)
    mpsraedyevlytigtgsygrcqkirrksdgkilvwkeldygsmteaekqmlvsevnllr
    elkhpnivryydriidrtnttlyivmeyceggdlasvitkgtkerqyldeefvlrvmtql
    tlalkechrrsdgghtvlhrdlkpanvfldgkqnvklgdfglarilnhdtsfaktfvgtp
    yymspeqmnrmsyneksdiwslgcllyelcalmppftafsqkelagkiregkfrripyry
    sdelneiitrmlnlkdyhrpsveeilenplilehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4afeA (A:)
    sraedyevlytigtgsygrcqkirrksdgkilvwkeldygsmteaekqmlvsevnllrel
    khpnivryydriidrtnttlyivmeyceggdlasvitkgtkerqyldeefvlrvmtqltl
    alkechrrshrdlkpanvfldgkqnvklgdfglvgtpyymspeqmnrneksdiwslgcll
    yelcalmppftafsqkelagkiregkfrripyrysdelneiitrmlnlkdyhrpsveeil
    enplilehhhhhh