PDB entry 4af3

View 4af3 on RCSB PDB site
Description: Human Aurora B Kinase in complex with INCENP and VX-680
Class: transferase/inhibitor
Keywords: transferase-inhibitor complex, aurkb
Deposited on 2012-01-16, released 2012-04-11
The last revision prior to the SCOPe 2.05 freeze date was dated 2012-09-26, with a file datestamp of 2012-09-21.
Experiment type: XRAY
Resolution: 2.75 Å
R-factor: 0.20776
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: aurora kinase b
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q96GD4
      • variant (245)
    Domains in SCOPe 2.05: d4af3a_
  • Chain 'D':
    Compound: Inner centromere protein
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed):
  • Heterogens: VX6, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4af3A (A:)
    smqkvmenssgtpdiltrhftiddfeigrplgkgkfgnvylarekkshfivalkvlfksq
    iekegvehqlrreieiqahlhhpnilrlynyfydrrriylileyaprgelykelqksctf
    deqrtatimeeladalmychgkkvihrdikpenlllglkgelkiadfgwsvhapslrrkt
    mcgtldylppemiegrmhnekvdlwcigvlcyellvgnppfesashnetyrrivkvdlkf
    pasvptgaqdliskllrhnpserlplaqvsahpwvransrrvlppsalqsva
    

    Sequence, based on observed residues (ATOM records): (download)
    >4af3A (A:)
    rhftiddfeigrplgkgkfgnvylarekkshfivalkvlfksqiekegvehqlrreieiq
    ahlhhpnilrlynyfydrrriylileyaprgelykelqksctfdeqrtatimeeladalm
    ychgkkvihrdikpenlllglkgelkiadfgldylppemiegrmhnekvdlwcigvlcye
    llvgnppfesashnetyrrivkvdlkfpasvptgaqdliskllrhnpserlplaqvsahp
    wvransrrvlpps
    

  • Chain 'D':
    No sequence available.