SCOPe 2.06: Structural Classification of Proteins

PDB entry 4aey

View 4aey on RCSB PDB site
Description: Crystal structure of FolX from Pseudomonas aeruginosa
Class: isomerase
Keywords: isomerase, pteridine biosynthesis
Deposited on 2012-01-13, released 2012-03-21
The last revision prior to the SCOPe 2.06 freeze date was dated 2012-06-20, with a file datestamp of 2012-06-15.
Experiment type: XRAY
Resolution: 3 Å
R-factor: 0.2843
AEROSPACI score: 0.16 (click here for full SPACI score report)

Chains and heterogens:

Chain 'A':
Compound: d-erythro-7,8-dihydroneopterin triphosphate epimerase
Species: Pseudomonas aeruginosa [TaxId:287]
Database cross-references and differences (RAF-indexed):
- Uniprot Q9HYG7
Domains in SCOPe 2.06: d4aeya_
Heterogens: HOH

PDB Chain Sequences:

Chain 'A':
Sequence, based on SEQRES records: (download)

>4aeyA (A:)
mhhhhhhgkpipnpllgldstenlyfqgidpftmprlepgmarirvkdlrlrtfigikee
eilnkqdvlinltilypaadavevndiehalnyrtitkaiirhveenrfallermtqeil
dlvmenpavryaevevdkphalrfaesvsitlaghr

Sequence, based on observed residues (ATOM records): (download)

>4aeyA (A:)
pgmarirvkdlrlrtfigikeeeilnkqdvlinltilypahalnyrtitkaiirhveenr
fallermtqeildlvmenpavryaevevdkphalrfaesvsitlagh