PDB entry 4ael

View 4ael on RCSB PDB site
Description: PDE10A in complex with the inhibitor AZ5
Class: hydrolase
Keywords: hydrolase, hit-to-lead, enzyme inhibitor, naphtyridine
Deposited on 2012-01-11, released 2012-01-25
The last revision prior to the SCOPe 2.07 freeze date was dated 2012-08-15, with a file datestamp of 2012-08-10.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.18955
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: camp and camp-inhibited cgmp 3', 5'-cyclic phosphodiesterase 10a
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9Y233 (2-End)
      • expression tag (2)
    Domains in SCOPe 2.07: d4aela1, d4aela2
  • Chain 'B':
    Compound: camp and camp-inhibited cgmp 3', 5'-cyclic phosphodiesterase 10a
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9Y233 (2-End)
      • expression tag (1-2)
    Domains in SCOPe 2.07: d4aelb1, d4aelb2
  • Heterogens: ZN, MG, 4HN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4aelA (A:)
    snasictseewqglmqftlpvrlckeielfhfdigpfenmwpgifvymvhrscgtscfel
    eklcrfimsvkknyrrvpyhnwkhavtvahcmyailqnnhtlftdlerkglliaclchdl
    dhrgfsnsylqkfdhplaalyststmeqhhfsqtvsilqleghnifstlssseyeqvlei
    irkaiiatdlalyfgnrkqleemyqtgslnlnnqshrdrviglmmtacdlcsvtklwpvt
    kltandiyaefwaegdemkklgiqpipmmdrdkkdevpqgqlgfynavaipcyttltqil
    pptepllkacrdnlsqwekvirgeetatwisspsvaqkaaased
    

    Sequence, based on observed residues (ATOM records): (download)
    >4aelA (A:)
    asictseewqglmqftlpvrlckeielfhfdigpfenmwpgifvymvhrscgtscfelek
    lcrfimsvkknyrrvpyhnwkhavtvahcmyailqnnhtlftdlerkglliaclchdldh
    rgfsnsylqkfdhplaalyststmeqhhfsqtvsilqleghnifstlssseyeqvleiir
    kaiiatdlalyfgnrkqleemyqtgslnlnnqshrdrviglmmtacdlcsvtklwpvtkl
    tandiyaefwaegdemkklgiqpipmmdrdkkdevpqgqlgfynavaipcyttltqilpp
    tepllkacrdnlsqwekvir
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4aelB (B:)
    snasictseewqglmqftlpvrlckeielfhfdigpfenmwpgifvymvhrscgtscfel
    eklcrfimsvkknyrrvpyhnwkhavtvahcmyailqnnhtlftdlerkglliaclchdl
    dhrgfsnsylqkfdhplaalyststmeqhhfsqtvsilqleghnifstlssseyeqvlei
    irkaiiatdlalyfgnrkqleemyqtgslnlnnqshrdrviglmmtacdlcsvtklwpvt
    kltandiyaefwaegdemkklgiqpipmmdrdkkdevpqgqlgfynavaipcyttltqil
    pptepllkacrdnlsqwekvirgeetatwisspsvaqkaaased
    

    Sequence, based on observed residues (ATOM records): (download)
    >4aelB (B:)
    nasictseewqglmqftlpvrlckeielfhfdigpfenmwpgifvymvhrscgtscfele
    klcrfimsvkknyrrvpyhnwkhavtvahcmyailqnnhtlftdlerkglliaclchdld
    hrgfsnsylqkfdhplaalyststmeqhhfsqtvsilqleghnifstlssseyeqvleii
    rkaiiatdlalyfgnrkqleemyqtgslnlnnqshrdrviglmmtacdlcsvtklwpvtk
    ltandiyaefwaegdemkklgiqpipmmdrdkkdevpqgqlgfynavaipcyttltqilp
    ptepllkacrdnlsqwekvirge