PDB entry 4aei

View 4aei on RCSB PDB site
Description: Crystal structure of the AaHII-Fab4C1 complex
Class: immune system/toxin
Keywords: immune system-toxin complex, alpha-toxin, conformational rearrangement, combining site, epitope, pharmacological site, venom, voltage-activated sodium channel
Deposited on 2012-01-10, released 2012-03-07
The last revision prior to the SCOPe 2.06 freeze date was dated 2012-05-02, with a file datestamp of 2012-04-27.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.20135
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: alpha-mammal toxin aah2
    Species: ANDROCTONUS AUSTRALIS HECTOR [TaxId:70175]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4aeia_
  • Chain 'B':
    Compound: alpha-mammal toxin aah2
    Species: ANDROCTONUS AUSTRALIS HECTOR [TaxId:70175]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4aeib_
  • Chain 'C':
    Compound: alpha-mammal toxin aah2
    Species: ANDROCTONUS AUSTRALIS HECTOR [TaxId:70175]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4aeic_
  • Chain 'H':
    Compound: fab antibody heavy chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 4AEI (0-End)
  • Chain 'I':
    Compound: fab antibody heavy chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 4AEI (0-End)
  • Chain 'J':
    Compound: fab antibody heavy chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 4AEI (0-End)
  • Chain 'L':
    Compound: fab antibody light chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 4AEI (0-End)
    Domains in SCOPe 2.06: d4aeil1, d4aeil2
  • Chain 'M':
    Compound: fab antibody light chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 4AEI (0-End)
    Domains in SCOPe 2.06: d4aeim1, d4aeim2
  • Chain 'N':
    Compound: fab antibody light chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 4AEI (0-End)
    Domains in SCOPe 2.06: d4aein1, d4aein2
  • Heterogens: CL, EPE, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4aeiA (A:)
    vkdgyivddvnctyfcgrnaycneectklkgesgycqwaspygnacycyklpdhvrtkgp
    grch
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4aeiB (B:)
    vkdgyivddvnctyfcgrnaycneectklkgesgycqwaspygnacycyklpdhvrtkgp
    grch
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4aeiC (C:)
    vkdgyivddvnctyfcgrnaycneectklkgesgycqwaspygnacycyklpdhvrtkgp
    grch
    

  • Chain 'H':
    No sequence available.

  • Chain 'I':
    No sequence available.

  • Chain 'J':
    No sequence available.

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >4aeiL (L:)
    dvlmtqsplslpvslgdqasiscrssqsivhsngntylewylqkpgqspnlliykvsnrf
    sgvpdrfsgsgsgtdftlkisrveaedlgvyycfqgshvpltfgagtklelkradaaptv
    sifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysm
    sstltltkdeyerhnsytceathktstspivksfnrnec
    

    Sequence, based on observed residues (ATOM records): (download)
    >4aeiL (L:)
    dvlmtqsplslpvslgdqasiscrssqsivhsngntylewylqkpgqspnlliykvsnrf
    sgvpdrfsgsgsgtdftlkisrveaedlgvyycfqgshvpltfgagtklelkradaaptv
    sifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysm
    sstltltkdeyerhnsytceathktstspivksfnrne
    

  • Chain 'M':
    Sequence, based on SEQRES records: (download)
    >4aeiM (M:)
    dvlmtqsplslpvslgdqasiscrssqsivhsngntylewylqkpgqspnlliykvsnrf
    sgvpdrfsgsgsgtdftlkisrveaedlgvyycfqgshvpltfgagtklelkradaaptv
    sifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysm
    sstltltkdeyerhnsytceathktstspivksfnrnec
    

    Sequence, based on observed residues (ATOM records): (download)
    >4aeiM (M:)
    dvlmtqsplslpvslgdqasiscrssqsivhsngntylewylqkpgqspnlliykvsnrf
    sgvpdrfsgsgsgtdftlkisrveaedlgvyycfqgshvpltfgagtklelkradaaptv
    sifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysm
    sstltltkdeyerhnsytceathktstspivksfnrn
    

  • Chain 'N':
    Sequence, based on SEQRES records: (download)
    >4aeiN (N:)
    dvlmtqsplslpvslgdqasiscrssqsivhsngntylewylqkpgqspnlliykvsnrf
    sgvpdrfsgsgsgtdftlkisrveaedlgvyycfqgshvpltfgagtklelkradaaptv
    sifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysm
    sstltltkdeyerhnsytceathktstspivksfnrnec
    

    Sequence, based on observed residues (ATOM records): (download)
    >4aeiN (N:)
    dvlmtqsplslpvslgdqasiscrssqsivhsngntylewylqkpgqspnlliykvsnrf
    sgvpdrfsgsgsgtdftlkisrveaedlgvyycfqgshvpltfgagtklelkradaaptv
    sifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysm
    sstltltkdeyerhnsytceathktstspivksfnrn