PDB entry 4ae6

View 4ae6 on RCSB PDB site
Description: A Crystal Structure of the Sperm Specific Isoform of Protein Kinase A (PKA) Subunit CalphaS Reveals a Binding Pocket for Hydrophobic Moieties
Class: transferase
Keywords: transferase
Deposited on 2012-01-09, released 2012-04-18
The last revision prior to the SCOPe 2.05 freeze date was dated 2013-01-30, with a file datestamp of 2013-01-25.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.21864
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: camp-dependent protein kinase catalytic subunit alpha 2
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d4ae6a_
  • Chain 'B':
    Compound: camp-dependent protein kinase catalytic subunit alpha 2
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d4ae6b_
  • Heterogens: ACT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4ae6A (A:)
    masnssdvkeflakakedflkkwespaqntahldqferiktlgtgsfgrvmlvkhketgn
    hyamkildkqkvvklkqiehtlnekrilqavnfpflvklefsfkdnsnlymvmeyvpgge
    mfshlrrigrfsepharfyaaqivltfeylhsldliyrdlkpenllidqqgyiqvtdfgf
    akrvkgrtwtlcgtpeylapeiilskgynkavdwwalgvliyemaagyppffadqpiqiy
    ekivsgkvrfpshfssdlkdllrnllqvdltkrfgnlkngvndiknhkwfattdwiaiyq
    rkveapfipkfkgpgdtsnfddyeeeeirvsinekcgkefsef
    

    Sequence, based on observed residues (ATOM records): (download)
    >4ae6A (A:)
    ssdvkeflakakedflkkwespaqntahldqferiktlgtgsfgrvmlvkhketgnhyam
    kildkqkvvklkqiehtlnekrilqavnfpflvklefsfkdnsnlymvmeyvpggemfsh
    lrrigrfsepharfyaaqivltfeylhsldliyrdlkpenllidqqgyiqvtdfgfakrv
    kgrtwtlcgtpeylapeiilskgynkavdwwalgvliyemaagyppffadqpiqiyekiv
    sgkvrfpshfssdlkdllrnllqvdltkrfgnlkngvndiknhkwfattdwiaiyqrkve
    apfipkfvsinekcgkefsef
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4ae6B (B:)
    masnssdvkeflakakedflkkwespaqntahldqferiktlgtgsfgrvmlvkhketgn
    hyamkildkqkvvklkqiehtlnekrilqavnfpflvklefsfkdnsnlymvmeyvpgge
    mfshlrrigrfsepharfyaaqivltfeylhsldliyrdlkpenllidqqgyiqvtdfgf
    akrvkgrtwtlcgtpeylapeiilskgynkavdwwalgvliyemaagyppffadqpiqiy
    ekivsgkvrfpshfssdlkdllrnllqvdltkrfgnlkngvndiknhkwfattdwiaiyq
    rkveapfipkfkgpgdtsnfddyeeeeirvsinekcgkefsef
    

    Sequence, based on observed residues (ATOM records): (download)
    >4ae6B (B:)
    keflakakedflkkwespaqntahldqferiktlgtgsfgrvmlvkhketgnhyamkild
    kqkvvklkqiehtlnekrilqavnfpflvklefsfkdnsnlymvmeyvpggemfshlrri
    grfsepharfyaaqivltfeylhsldliyrdlkpenllidqqgyiqvtdfgfakrvkgrt
    wtlcgtpeylapeiilskgynkavdwwalgvliyemaagyppffadqpiqiyekivsgkv
    rfpshfssdlkdllrnllqvdltkrfgnlkngvndiknhkwfattdwiaiyqrkveapfi
    pkfeeeeirvsinekcgkefsef