PDB entry 4adc

View 4adc on RCSB PDB site
Description: Structural and functional study of succinyl-ornithine transaminase from E. coli
Class: transferase
Keywords: transferase, plp enzymes, aminotransferase
Deposited on 2011-12-23, released 2013-01-16
The last revision prior to the SCOPe 2.07 freeze date was dated 2013-03-27, with a file datestamp of 2013-03-22.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.1724
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: succinylornithine transaminase
    Species: ESCHERICHIA COLI [TaxId:511693]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4adca_
  • Chain 'B':
    Compound: succinylornithine transaminase
    Species: ESCHERICHIA COLI [TaxId:511693]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4adcb_
  • Chain 'C':
    Compound: succinylornithine transaminase
    Species: ESCHERICHIA COLI [TaxId:511693]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4adcc_
  • Chain 'D':
    Compound: succinylornithine transaminase
    Species: ESCHERICHIA COLI [TaxId:511693]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4adcd_
  • Heterogens: PLP, NA, MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4adcA (A:)
    msqpitrenfdewmipvyapapfipvrgegsrlwdqqgkeyidfaggiavnalghahpel
    realneqaskfwhtgngytnepvlrlakklidatfadrvffcnsgaeaneaalklarkfa
    hdrygshksgivafknafhgrtlftvsaggqpaysqdfaplpadirhaayndinsasali
    ddstcavivepiqgeggvvpasnaflqglrelcnrhnallifdevqtgvgrtgelyaymh
    ygvtpdllttakalgggfpvgallateecarvmtvgthgttyggnplasavagkvlelin
    tpemlngvkqrhdwfverlntinhryglfsevrglglligcvlnadyagqakqisqeaak
    agvmvliaggnvvrfapalnvseeevttgldrfaaacehfvsrgss
    

    Sequence, based on observed residues (ATOM records): (download)
    >4adcA (A:)
    qpitrenfdewmipvyapapfipvrgegsrlwdqqgkeyidfaggiavnalghahpelre
    alneqaskfwhtgngytnepvlrlakklidatfadrvffcnsgaeaneaalklarkfahd
    rygshksgivafknafhgrtlftvsaggqpaysqdfaplpadirhaayndinsasalidd
    stcavivepiqgeggvvpasnaflqglrelcnrhnallifdevqtgvgrtgelyaymhyg
    vtpdllttakalgggfpvgallateecarvmtvgthgttyggnplasavagkvlelintp
    emlngvkqrhdwfverlntinhryglfsevrglglligcvlnadyagqakqisqeaakag
    vmvliaggnvvrfapalnvseeevttgldrfaaacehfvs
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4adcB (B:)
    msqpitrenfdewmipvyapapfipvrgegsrlwdqqgkeyidfaggiavnalghahpel
    realneqaskfwhtgngytnepvlrlakklidatfadrvffcnsgaeaneaalklarkfa
    hdrygshksgivafknafhgrtlftvsaggqpaysqdfaplpadirhaayndinsasali
    ddstcavivepiqgeggvvpasnaflqglrelcnrhnallifdevqtgvgrtgelyaymh
    ygvtpdllttakalgggfpvgallateecarvmtvgthgttyggnplasavagkvlelin
    tpemlngvkqrhdwfverlntinhryglfsevrglglligcvlnadyagqakqisqeaak
    agvmvliaggnvvrfapalnvseeevttgldrfaaacehfvsrgss
    

    Sequence, based on observed residues (ATOM records): (download)
    >4adcB (B:)
    qpitrenfdewmipvyapapfipvrgegsrlwdqqgkeyidfaggiavnalghahpelre
    alneqaskfwhtgngytnepvlrlakklidatfadrvffcnsgaeaneaalklarkfahd
    rygshksgivafknafhgrtlftvsaggqpaysqdfaplpadirhaayndinsasalidd
    stcavivepiqgeggvvpasnaflqglrelcnrhnallifdevqtgvgrtgelyaymhyg
    vtpdllttakalgggfpvgallateecarvmtvgthgttyggnplasavagkvlelintp
    emlngvkqrhdwfverlntinhryglfsevrglglligcvlnadyagqakqisqeaakag
    vmvliaggnvvrfapalnvseeevttgldrfaaacehfvs
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4adcC (C:)
    msqpitrenfdewmipvyapapfipvrgegsrlwdqqgkeyidfaggiavnalghahpel
    realneqaskfwhtgngytnepvlrlakklidatfadrvffcnsgaeaneaalklarkfa
    hdrygshksgivafknafhgrtlftvsaggqpaysqdfaplpadirhaayndinsasali
    ddstcavivepiqgeggvvpasnaflqglrelcnrhnallifdevqtgvgrtgelyaymh
    ygvtpdllttakalgggfpvgallateecarvmtvgthgttyggnplasavagkvlelin
    tpemlngvkqrhdwfverlntinhryglfsevrglglligcvlnadyagqakqisqeaak
    agvmvliaggnvvrfapalnvseeevttgldrfaaacehfvsrgss
    

    Sequence, based on observed residues (ATOM records): (download)
    >4adcC (C:)
    qpitrenfdewmipvyapapfipvrgegsrlwdqqgkeyidfaggiavnalghahpelre
    alneqaskfwhtgngytnepvlrlakklidatfadrvffcnsgaeaneaalklarkfahd
    rygshksgivafknafhgrtlftvsaggqpaysqdfaplpadirhaayndinsasalidd
    stcavivepiqgeggvvpasnaflqglrelcnrhnallifdevqtgvgrtgelyaymhyg
    vtpdllttakalgggfpvgallateecarvmtvgthgttyggnplasavagkvlelintp
    emlngvkqrhdwfverlntinhryglfsevrglglligcvlnadyagqakqisqeaakag
    vmvliaggnvvrfapalnvseeevttgldrfaaacehfvs
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >4adcD (D:)
    msqpitrenfdewmipvyapapfipvrgegsrlwdqqgkeyidfaggiavnalghahpel
    realneqaskfwhtgngytnepvlrlakklidatfadrvffcnsgaeaneaalklarkfa
    hdrygshksgivafknafhgrtlftvsaggqpaysqdfaplpadirhaayndinsasali
    ddstcavivepiqgeggvvpasnaflqglrelcnrhnallifdevqtgvgrtgelyaymh
    ygvtpdllttakalgggfpvgallateecarvmtvgthgttyggnplasavagkvlelin
    tpemlngvkqrhdwfverlntinhryglfsevrglglligcvlnadyagqakqisqeaak
    agvmvliaggnvvrfapalnvseeevttgldrfaaacehfvsrgss
    

    Sequence, based on observed residues (ATOM records): (download)
    >4adcD (D:)
    qpitrenfdewmipvyapapfipvrgegsrlwdqqgkeyidfaggiavnalghahpelre
    alneqaskfwhtgngytnepvlrlakklidatfadrvffcnsgaeaneaalklarkfahd
    rygshksgivafknafhgrtlftvsaggqpaysqdfaplpadirhaayndinsasalidd
    stcavivepiqgeggvvpasnaflqglrelcnrhnallifdevqtgvgrtgelyaymhyg
    vtpdllttakalgggfpvgallateecarvmtvgthgttyggnplasavagkvlelintp
    emlngvkqrhdwfverlntinhryglfsevrglglligcvlnadyagqakqisqeaakag
    vmvliaggnvvrfapalnvseeevttgldrfaaacehfvs