PDB entry 4acs

View 4acs on RCSB PDB site
Description: Crystal structure of mutant GST A2-2 with enhanced catalytic efficiency with azathioprine
Class: transferase
Keywords: transferase, oxidation-reduction
Deposited on 2011-12-19, released 2011-12-28
The last revision prior to the SCOPe 2.06 freeze date was dated 2012-04-04, with a file datestamp of 2012-03-30.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.26425
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: glutathione s-transferase a2
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P09210 (Start-220)
      • engineered mutation (106-107)
      • conflict (109)
      • engineered mutation (221)
    Domains in SCOPe 2.06: d4acsa1, d4acsa2
  • Chain 'B':
    Compound: glutathione s-transferase a2
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P09210
      • engineered mutation (106-107)
      • conflict (109)
    Domains in SCOPe 2.06: d4acsb1, d4acsb2
  • Chain 'C':
    Compound: glutathione s-transferase a2
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P09210 (Start-220)
      • engineered mutation (106-107)
      • conflict (109)
      • engineered mutation (221)
    Domains in SCOPe 2.06: d4acsc1, d4acsc2
  • Chain 'D':
    Compound: glutathione s-transferase a2
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P09210
      • engineered mutation (106-107)
      • conflict (109)
    Domains in SCOPe 2.06: d4acsd1, d4acsd2
  • Heterogens: GSH, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4acsA (A:)
    maekpklhysnirgrmesirwllaaagvefeekfiksaedldklrndgylmfqqvpmvei
    dgmklvqtrailnyiaskynlygkdikekalidmyiegiadlgemigdlsfsqpeeqdak
    laliqektknryfpafekvlkshgqdylvgnklsradihlvellyyveeldsslissfpl
    lkalktrisnlptvkkflqpgsprkppmdeksleesrkifrh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4acsA (A:)
    kpklhysnirgrmesirwllaaagvefeekfiksaedldklrndgylmfqqvpmveidgm
    klvqtrailnyiaskynlygkdikekalidmyiegiadlgemigdlsfsqpeeqdaklal
    iqektknryfpafekvlkshgqdylvgnklsradihlvellyyveeldsslissfpllka
    lktrisnlptvkkflqpgsprkppmdeksleesrkifrh
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4acsB (B:)
    maekpklhysnirgrmesirwllaaagvefeekfiksaedldklrndgylmfqqvpmvei
    dgmklvqtrailnyiaskynlygkdikekalidmyiegiadlgemigdlsfsqpeeqdak
    laliqektknryfpafekvlkshgqdylvgnklsradihlvellyyveeldsslissfpl
    lkalktrisnlptvkkflqpgsprkppmdeksleesrkifrh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4acsB (B:)
    kpklhysnirgrmesirwllaaagvefeekfiksaedldklrndgylmfqqvpmveidgm
    klvqtrailnyiaskynlygkdikekalidmyiegiadlgemigdlsfsqpeeqdaklal
    iqektknryfpafekvlkshgqdylvgnklsradihlvellyyveeldsslissfpllka
    lktrisnlptvkkflqpgsprkppmdeksleesrkif
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4acsC (C:)
    maekpklhysnirgrmesirwllaaagvefeekfiksaedldklrndgylmfqqvpmvei
    dgmklvqtrailnyiaskynlygkdikekalidmyiegiadlgemigdlsfsqpeeqdak
    laliqektknryfpafekvlkshgqdylvgnklsradihlvellyyveeldsslissfpl
    lkalktrisnlptvkkflqpgsprkppmdeksleesrkifrh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4acsC (C:)
    kpklhysnirgrmesirwllaaagvefeekfiksaedldklrndgylmfqqvpmveidgm
    klvqtrailnyiaskynlygkdikekalidmyiegiadlgemigdlsfsqpeeqdaklal
    iqektknryfpafekvlkshgqdylvgnklsradihlvellyyveeldsslissfpllka
    lktrisnlptvkkflqpgsprkppmdeksleesrkifrh
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >4acsD (D:)
    maekpklhysnirgrmesirwllaaagvefeekfiksaedldklrndgylmfqqvpmvei
    dgmklvqtrailnyiaskynlygkdikekalidmyiegiadlgemigdlsfsqpeeqdak
    laliqektknryfpafekvlkshgqdylvgnklsradihlvellyyveeldsslissfpl
    lkalktrisnlptvkkflqpgsprkppmdeksleesrkifrh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4acsD (D:)
    kpklhysnirgrmesirwllaaagvefeekfiksaedldklrndgylmfqqvpmveidgm
    klvqtrailnyiaskynlygkdikekalidmyiegiadlgemigdlsfsqpeeqdaklal
    iqektknryfpafekvlkshgqdylvgnklsradihlvellyyveeldsslissfpllka
    lktrisnlptvkkflqpgsprkppmdeksleesrkif