PDB entry 4acd

View 4acd on RCSB PDB site
Description: GSK3b in complex with inhibitor
Class: transferase
Keywords: transferase
Deposited on 2011-12-15, released 2012-05-16
The last revision prior to the SCOPe 2.06 freeze date was dated 2012-11-21, with a file datestamp of 2012-11-16.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.1803
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Glycogen synthase kinase-3 beta
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4acda_
  • Chain 'B':
    Compound: Glycogen synthase kinase-3 beta
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4acdb_
  • Heterogens: GR9, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4acdA (A:)
    msyyhhhhhhdydipttenlyfqgamgsshhhhhhssglvprgshmsgrprttsfaesck
    pvqqpsafgsmkvsrdkdgskvttvvatpgqgpdrpqevsytdtkvigngsfgvvyqakl
    cdsgelvaikkvlqdkrfknrelqimrkldhcnivrlryffyssgekkdevylnlvldyv
    petvyrvarhysrakqtlpviyvklymyqlfrslayihsfgichrdikpqnllldpdtav
    lklcdfgsakqlvrgepnvsyicsryyrapelifgatdytssidvwsagcvlaelllgqp
    ifpgdsgvdqlveiikvlgtptreqiremnpnytefkfpqikahpwtkvfrprtppeaia
    lcsrlleytptarltpleacahsffdelrdpnvklpngrdtpalfnfttqelssnpplat
    ilipphariqaaastptnataasdantgdrgqtnnaasasasnst
    

    Sequence, based on observed residues (ATOM records): (download)
    >4acdA (A:)
    skvttvvatpgqgpdrpqevsytdtkvigngsfgvvyqaklcdsgelvaikkvlqdkrfk
    nrelqimrkldhcnivrlryffyssgekkdevylnlvldyvpetvyrvarhysrakqtlp
    viyvklymyqlfrslayihsfgichrdikpqnllldpdtavlklcdfgsakqlvrgepnv
    syicsryyrapelifgatdytssidvwsagcvlaelllgqpifpgdsgvdqlveiikvlg
    tptreqiremnpnytefkfpqikahpwtkvfrprtppeaialcsrlleytptarltplea
    cahsffdelrdpnvklpngrdtpalfnfttqelssnpplatilipphariq
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4acdB (B:)
    msyyhhhhhhdydipttenlyfqgamgsshhhhhhssglvprgshmsgrprttsfaesck
    pvqqpsafgsmkvsrdkdgskvttvvatpgqgpdrpqevsytdtkvigngsfgvvyqakl
    cdsgelvaikkvlqdkrfknrelqimrkldhcnivrlryffyssgekkdevylnlvldyv
    petvyrvarhysrakqtlpviyvklymyqlfrslayihsfgichrdikpqnllldpdtav
    lklcdfgsakqlvrgepnvsyicsryyrapelifgatdytssidvwsagcvlaelllgqp
    ifpgdsgvdqlveiikvlgtptreqiremnpnytefkfpqikahpwtkvfrprtppeaia
    lcsrlleytptarltpleacahsffdelrdpnvklpngrdtpalfnfttqelssnpplat
    ilipphariqaaastptnataasdantgdrgqtnnaasasasnst
    

    Sequence, based on observed residues (ATOM records): (download)
    >4acdB (B:)
    skvttvvatpgqgpdrpqevsytdtkvigngsfgvvyqaklcdsgelvaikkvlqdkrfk
    nrelqimrkldhcnivrlryffyssgekkdevylnlvldyvpetvyrvarhysrakqtlp
    viyvklymyqlfrslayihsfgichrdikpqnllldpdtavlklcdfgsakqlvrgepnv
    syicsryyrapelifgatdytssidvwsagcvlaelllgqpifpgdsgvdqlveiikvlg
    tptreqiremnpnytefkfpqikahpwtkvfrprtppeaialcsrlleytptarltplea
    cahsffdelrdpnvklpngrdtpalfnfttqelssnpplatilipphariq