PDB entry 4acc

View 4acc on RCSB PDB site
Description: GSK3b in complex with inhibitor
Class: transferase
Keywords: transferase
Deposited on 2011-12-14, released 2012-05-16
The last revision prior to the SCOPe 2.05 freeze date was dated 2012-11-21, with a file datestamp of 2012-11-16.
Experiment type: XRAY
Resolution: 2.21 Å
R-factor: 0.1907
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Glycogen synthase kinase-3 beta
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d4acca_
  • Chain 'B':
    Compound: Glycogen synthase kinase-3 beta
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d4accb_
  • Heterogens: DMS, 7YG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4accA (A:)
    msyyhhhhhhdydipttenlyfqgamgsshhhhhhssglvprgshmsgrprttsfaesck
    pvqqpsafgsmkvsrdkdgskvttvvatpgqgpdrpqevsytdtkvigngsfgvvyqakl
    cdsgelvaikkvlqdkrfknrelqimrkldhcnivrlryffyssgekkdevylnlvldyv
    petvyrvarhysrakqtlpviyvklymyqlfrslayihsfgichrdikpqnllldpdtav
    lklcdfgsakqlvrgepnvsyicsryyrapelifgatdytssidvwsagcvlaelllgqp
    ifpgdsgvdqlveiikvlgtptreqiremnpnytefkfpqikahpwtkvfrprtppeaia
    lcsrlleytptarltpleacahsffdelrdpnvklpngrdtpalfnfttqelssnpplat
    ilipphariqaaastptnataasdantgdrgqtnnaasasasnst
    

    Sequence, based on observed residues (ATOM records): (download)
    >4accA (A:)
    skvttvvatpgqgpdrpqevsytdtkvigngsfgvvyqaklcdsgelvaikkvlqdkrfk
    nrelqimrkldhcnivrlryffyssgekkdevylnlvldyvpetvyrvarhysrakqtlp
    viyvklymyqlfrslayihsfgichrdikpqnllldpdtavlklcdfgsakqlvrgepnv
    syicsryyrapelifgatdytssidvwsagcvlaelllgqpifpgdsgvdqlveiikvlg
    tptreqiremnpnytefkfpqikahpwtkvfrprtppeaialcsrlleytptarltplea
    cahsffdelrdpnvklpngrdtpalfnfttqelssnpplatilipphariq
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4accB (B:)
    msyyhhhhhhdydipttenlyfqgamgsshhhhhhssglvprgshmsgrprttsfaesck
    pvqqpsafgsmkvsrdkdgskvttvvatpgqgpdrpqevsytdtkvigngsfgvvyqakl
    cdsgelvaikkvlqdkrfknrelqimrkldhcnivrlryffyssgekkdevylnlvldyv
    petvyrvarhysrakqtlpviyvklymyqlfrslayihsfgichrdikpqnllldpdtav
    lklcdfgsakqlvrgepnvsyicsryyrapelifgatdytssidvwsagcvlaelllgqp
    ifpgdsgvdqlveiikvlgtptreqiremnpnytefkfpqikahpwtkvfrprtppeaia
    lcsrlleytptarltpleacahsffdelrdpnvklpngrdtpalfnfttqelssnpplat
    ilipphariqaaastptnataasdantgdrgqtnnaasasasnst
    

    Sequence, based on observed residues (ATOM records): (download)
    >4accB (B:)
    skvttvvatpgqgpdrpqevsytdtkvigngsfgvvyqaklcdsgelvaikkvlqdkrfk
    nrelqimrkldhcnivrlryffyssgekkdevylnlvldyvpetvyrvarhysrakqtlp
    viyvklymyqlfrslayihsfgichrdikpqnllldpdtavlklcdfgsakqlvrgepnv
    syicsryyrapelifgatdytssidvwsagcvlaelllgqpifpgdsgvdqlveiikvlg
    tptreqiremnpnytefkfpqikahpwtkvfrprtppeaialcsrlleytptarltplea
    cahsffdelrdpnvklpngrdtpalfnfttqelssnpplatilipphariq