PDB entry 4acb

View 4acb on RCSB PDB site
Description: crystal structure of translation elongation factor selb from methanococcus maripaludis in complex with the GTP analogue gppnhp
Class: translation
Keywords: selenocysteine, translation, secis element, ef-sec, sec-tRNA(sec)
Deposited on 2011-12-14, released 2012-11-07
The last revision prior to the SCOPe 2.08 freeze date was dated 2012-11-07, with a file datestamp of 2012-11-02.
Experiment type: XRAY
Resolution: 3.34 Å
R-factor: 0.1809
AEROSPACI score: 0.21 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: translation elongation factor selb
    Species: METHANOCOCCUS MARIPALUDIS [TaxId:39152]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8J307 (14-481)
      • expression tag (13)
    Domains in SCOPe 2.08: d4acba1, d4acba2, d4acba3, d4acba4, d4acba5
  • Chain 'B':
    Compound: translation elongation factor selb
    Species: METHANOCOCCUS MARIPALUDIS [TaxId:39152]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d4acbb1, d4acbb2, d4acbb3, d4acbb4
  • Chain 'C':
    Compound: translation elongation factor selb
    Species: METHANOCOCCUS MARIPALUDIS [TaxId:39152]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8J307 (14-481)
      • expression tag (11-13)
    Domains in SCOPe 2.08: d4acbc1, d4acbc2, d4acbc3, d4acbc4, d4acbc5
  • Chain 'D':
    Compound: translation elongation factor selb
    Species: METHANOCOCCUS MARIPALUDIS [TaxId:39152]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d4acbd1, d4acbd2, d4acbd3, d4acbd4
  • Heterogens: GNP, MG, GDP, SO4, DXC, 5GP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4acbA (A:)
    mhhhhhhsiegrphmdfkninlgifghidhgkttlskvlteiastsahdklpesqkrgit
    idigfsafklenyritlvdapghadliravvsaadiidlalivvdakegpktqtgehmli
    ldhfnipiivvitksdnagteeikrtemimksilqsthnlknssiipisaktgfgvdelk
    nliittlnnaeiirntesyfkmpldhafpikgagtvvtgtinkgivkvgdelkvlpinms
    tkvrsiqyfkesvmeakagdrvgmaiqgvdakqiyrgciltskdtklqtvdkivakikis
    difkynltpkmkvhlnvgmlivpavavpfkkvtfgkteeniilnevisgnecycafelee
    kvlaevgdrvlitrldlppttlricghglieefkpikdlnikkevlregkvkidkgrtvi
    dglaqskvaaekligeeisiegkdivgkikgtfgtkglltaefsgnvenrdkvilnrlrr
    wg
    

    Sequence, based on observed residues (ATOM records): (download)
    >4acbA (A:)
    hmdfkninlgifghidhgkttlskvlteitidigfsafklenyritlvdapghadlirav
    vsaadiidlalivvdakegpktqtgehmlildhfnipiivvitksdnagteeikrtemim
    ksilqsthnlknssiipisaktgfgvdelknliittlnnaeiirntesyfkmpldhafpi
    kgagtvvtgtinkgivkvgdelkvlpinmstkvrsiqyfkesvmeakagdrvgmaiqgvd
    akqiyrgciltskdtklqtvdkivakikisdifkynltpkmkvhlnvgmlivpavavpfk
    kvtfgkteeniilnevisgnecycafeleekvlaevgdrvlitrldlppttlricghgli
    eefkpikdlnikkevlregkvkidkgrtvidglaqskvaaekligeeisiegkdivgkik
    gtfgtkglltaefsgnvenrdkvilnrlrrwg
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4acbB (B:)
    mhhhhhhsiegrphmdfkninlgifghidhgkttlskvlteiastsahdklpesqkrgit
    idigfsafklenyritlvdapghadliravvsaadiidlalivvdakegpktqtgehmli
    ldhfnipiivvitksdnagteeikrtemimksilqsthnlknssiipisaktgfgvdelk
    nliittlnnaeiirntesyfkmpldhafpikgagtvvtgtinkgivkvgdelkvlpinms
    tkvrsiqyfkesvmeakagdrvgmaiqgvdakqiyrgciltskdtklqtvdkivakikis
    difkynltpkmkvhlnvgmlivpavavpfkkvtfgkteeniilnevisgnecycafelee
    kvlaevgdrvlitrldlppttlricghglieefkpikdlnikkevlregkvkidkgrtvi
    dglaqskvaaekligeeisiegkdivgkikgtfgtkglltaefsgnvenrdkvilnrlrr
    wg
    

    Sequence, based on observed residues (ATOM records): (download)
    >4acbB (B:)
    mdfkninlgifghidhgkttlskvlteiakrgitidigfsafklenyritlvdapghadl
    iravvsaadiidlalivvdakegpktqtgehmlildhfnipiivvitksdnagteeikrt
    emimksilqsthnlknssiipisaktgfgvdelknliittlnnaeiirntesyfkmpldh
    afpikgagtvvtgtinkgivkvgdelkvlpinmstkvrsiqyfkesvmeakagdrvgmai
    qgvdakqiyrgciltskdtklqtvdkivakikisdifkynltpkmkvhlnvgmlivpava
    vpfkkvtfgkteeniilnevisgnecycafeleekvlaevgdrvlitrldlppttlricg
    hglieefkpikdlnikkevlregkvkidkgrtvidglaqskvaaekligeeisiegkdiv
    gkikgtfgtkglltaefsgnvenrdkvilnrlrrwg
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4acbC (C:)
    mhhhhhhsiegrphmdfkninlgifghidhgkttlskvlteiastsahdklpesqkrgit
    idigfsafklenyritlvdapghadliravvsaadiidlalivvdakegpktqtgehmli
    ldhfnipiivvitksdnagteeikrtemimksilqsthnlknssiipisaktgfgvdelk
    nliittlnnaeiirntesyfkmpldhafpikgagtvvtgtinkgivkvgdelkvlpinms
    tkvrsiqyfkesvmeakagdrvgmaiqgvdakqiyrgciltskdtklqtvdkivakikis
    difkynltpkmkvhlnvgmlivpavavpfkkvtfgkteeniilnevisgnecycafelee
    kvlaevgdrvlitrldlppttlricghglieefkpikdlnikkevlregkvkidkgrtvi
    dglaqskvaaekligeeisiegkdivgkikgtfgtkglltaefsgnvenrdkvilnrlrr
    wg
    

    Sequence, based on observed residues (ATOM records): (download)
    >4acbC (C:)
    rphmdfkninlgifghidhgkttlskvlteiastsahdklpesqkrgitidigfsafkle
    nyritlvdapghadliravvsaadiidlalivvdakegpktqtgehmlildhfnipiivv
    itksdnagteeikrtemimksilqsthnlknssiipisaktgfgvdelknliittlnnae
    iirntesyfkmpldhafpikgagtvvtgtinkgivkvgdelkvlpinmstkvrsiqyfke
    svmeakagdrvgmaiqgvdakqiyrgciltskdtklqtvdkivakikisdifkynltpkm
    kvhlnvgmlivpavavpfkkvtfgkteeniilnevisgnecycafeleekvlaevgdrvl
    itrldlppttlricghglieefkpikdlnikkevlregkvkidkgrtvidglaqskvaae
    kligeeisiegkdivgkikgtfgtkglltaefsgnvenrdkvilnrlrrwg
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >4acbD (D:)
    mhhhhhhsiegrphmdfkninlgifghidhgkttlskvlteiastsahdklpesqkrgit
    idigfsafklenyritlvdapghadliravvsaadiidlalivvdakegpktqtgehmli
    ldhfnipiivvitksdnagteeikrtemimksilqsthnlknssiipisaktgfgvdelk
    nliittlnnaeiirntesyfkmpldhafpikgagtvvtgtinkgivkvgdelkvlpinms
    tkvrsiqyfkesvmeakagdrvgmaiqgvdakqiyrgciltskdtklqtvdkivakikis
    difkynltpkmkvhlnvgmlivpavavpfkkvtfgkteeniilnevisgnecycafelee
    kvlaevgdrvlitrldlppttlricghglieefkpikdlnikkevlregkvkidkgrtvi
    dglaqskvaaekligeeisiegkdivgkikgtfgtkglltaefsgnvenrdkvilnrlrr
    wg
    

    Sequence, based on observed residues (ATOM records): (download)
    >4acbD (D:)
    dfkninlgifghidhgkttlskvlteiastsahdklpesqkrgitidigfsafklenyri
    tlvdapghadliravvsaadiidlalivvdakegpktqtgehmlildhfnipiivvitks
    dnagteeikrtemimksilqsthnlknssiipisaktgfgvdelknliittlnnaeiirn
    tesyfkmpldhafpikgagtvvtgtinkgivkvgdelkvlpinmstkvrsiqyfkesvme
    akagdrvgmaiqgvdakqiyrgciltskdtklqtvdkivakikisdifkynltpkmkvhl
    nvgmlivpavavpfkkvtfgkteeniilnevisgnecycafeleekvlaevgdrvlitrl
    dlppttlricghglieefkpikdlnikkevlregkvkidkgrtvidglaqskvaaeklig
    eeisiegkdivgkikgtfgtkglltaefsgnvenrdkvilnrlrrwg