PDB entry 4ac7

View 4ac7 on RCSB PDB site
Description: The crystal structure of Sporosarcina pasteurii urease in complex with citrate
Class: hydrolase
Keywords: hydrolase, bacillus pasteurii
Deposited on 2011-12-14, released 2013-01-16
The last revision prior to the SCOPe 2.06 freeze date was dated 2014-12-03, with a file datestamp of 2014-11-28.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: 0.11847
AEROSPACI score: 0.62 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Urease subunit gamma
    Species: SPOROSARCINA PASTEURII [TaxId:1474]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4ac7a_
  • Chain 'B':
    Compound: urease subunit beta
    Species: SPOROSARCINA PASTEURII [TaxId:1474]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4ac7b_
  • Chain 'C':
    Compound: urease subunit alpha
    Species: SPOROSARCINA PASTEURII [TaxId:1474]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P41020 (0-569)
      • conflict (18)
      • conflict (27)
      • insertion (28)
      • conflict (35-37)
      • conflict (262)
      • conflict (419)
    Domains in SCOPe 2.06: d4ac7c1, d4ac7c2
  • Heterogens: EDO, SO4, NI, OH, FLC, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4ac7A (A:)
    mhlnpaekeklqiflaselllrrkarglklnypeavaiitsfimegardgktvamlmeeg
    khvltrddvmegvpemiddiqaeatfpdgtklvtvhnpis
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4ac7B (B:)
    msnnnyivpgeyrvaegeieinagrekttirvsntgdrpiqvgshihfvevnkellfdra
    egigrrlnipsgtaarfepgeemeveltelggnrevfgisdltngsvdnkelilqrakel
    gykgve
    

    Sequence, based on observed residues (ATOM records): (download)
    >4ac7B (B:)
    nyivpgeyrvaegeieinagrekttirvsntgdrpiqvgshihfvevnkellfdraegig
    rrlnipsgtaarfepgeemeveltelggnrevfgisdltngsvdnkelilqrakelgykg
    ve
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4ac7C (C:)
    mkinrqqyaesygptvgdevrladtdlwievekdyttygdevnfgggkvlregmgengty
    trtenvldllltnalildytgiykadigvkdgyivgigkggnpdimdgvtpnmivgtate
    viaaegkivtaggidthvhfinpdqvdvalangittlfgggtgpaegskattvtpgpwni
    ekmlksteglpinvgilgkghgssiapimeqidagaaglkihedwgatpasidrsltvad
    eadvqvaihsdtlneagfledtlraingrvihsfhvegaggghapdimamaghpnvlpss
    tnptrpftvntidehldmlmvchhlkqnipedvafadsrirpetiaaedilhdlgiismm
    stdalamgragemvlrtwqtadkmkkqrgplaeekngsdnfrlkryvskytinpaiaqgi
    ahevgsieegkfadlvlwepkffgvkadrvikggiiayaqigdpsasiptpqpvmgrrmy
    gtvgdlihdtnitfmskssiqqgvpaklglkrrigtvkncrnigkkdmkwndvttdidin
    petyevkvdgevltcepvkelpmaqryflf