PDB entry 4ac0

View 4ac0 on RCSB PDB site
Description: tetr(b) in complex with minocycline and magnesium
Class: transcription
Keywords: transcription
Deposited on 2011-12-12, released 2012-12-26
The last revision prior to the SCOPe 2.07 freeze date was dated 2012-12-26, with a file datestamp of 2012-12-21.
Experiment type: XRAY
Resolution: 2.45 Å
R-factor: 0.237
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: tetracycline repressor protein class b from transposon tn1 0
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4ac0a1, d4ac0a2
  • Heterogens: MIY, MG, PO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4ac0A (A:)
    srldkskvinsalellnevgieglttrklaqklgveqptlywhvknkralldalaiemld
    rhhthfcplegeswqdflrnnaksfrcallshrdgakvhlgtrptekqyetlenqlaflc
    qqgfslenalyalsavghftlgcvledqehqvakeeretpttdsmppllrqaielfdhqg
    aepaflfgleliicglekqlkc
    

    Sequence, based on observed residues (ATOM records): (download)
    >4ac0A (A:)
    srldkskvinsalellnevgieglttrklaqklgveqptlywhvknkralldalaiemld
    rhhthfcplegeswqdflrnnaksfrcallshrdgakvhlgtrptekqyetlenqlaflc
    qqgfslenalyalsavghftlgcvledqehqvakeeresmppllrqaielfdhqgaepaf
    lfgleliicglekqlkc