PDB entry 4aah

View 4aah on RCSB PDB site
Description: methanol dehydrogenase from methylophilus w3a1
Class: oxidoreductase (pqq(a)-choh(d))
Keywords: oxidoreductase (pqq(a)-choh(d))
Deposited on 1996-03-10, released 1996-12-07
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.152
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: methanol dehydrogenase
    Species: METHYLOPHILUS METHYLOTROPHUS [TaxId:2327]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4aaha_
  • Chain 'B':
    Compound: methanol dehydrogenase
    Species: METHYLOPHILUS METHYLOTROPHUS [TaxId:2327]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4aahb_
  • Chain 'C':
    Compound: methanol dehydrogenase
    Species: METHYLOPHILUS METHYLOTROPHUS [TaxId:2327]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4aahc_
  • Chain 'D':
    Compound: methanol dehydrogenase
    Species: METHYLOPHILUS METHYLOTROPHUS [TaxId:2327]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4aahd_
  • Heterogens: CA, PQQ, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4aahA (A:)
    dadldkqvntagawpiatggyysqhnsplaqinksnvknvkaawsfstgvlnghegaplv
    igdmmyvhsafpnntyalnlndpgkivwqhkpkqdastkavmccdvvdrglaygagqivk
    kqanghllaldaktgkinwevevcdpkvgstltqapfvakdtvlmgcsgaelgvrgavna
    fdlktgelkwrafatgsddsvrlakdfnsanphygqfglgtktwegdawkigggtnwgwy
    aydpklnlfyygsgnpapwnetmrpgdnkwtmtiwgrdldtgmakwgyqktphdewdfag
    vnqmvltdqpvngkmtpllshidrngilytlnrengnlivaekvdpavnvfkkvdlktgt
    pvrdpefatrmdhkgtnicpsamgfhnqgvdsydpesrtlyaglnhicmdwepfmlpyra
    gqffvgatlamypgpngptkkemgqirafdlttgkakwtkwekfaawggtlytkgglvwy
    atldgylkaldnkdgkelwnfkmpsggigspmtysfkgkqyigsmygvggwpgvglvfdl
    tdpsaglgavgafrelqnhtqmggglmvfsl
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4aahB (B:)
    ydgqnckepgncwenkpgypekiagskydpkhdpvelnkqeesikamdarnakrianaks
    sgnfvfdvk
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4aahC (C:)
    dadldkqvntagawpiatggyysqhnsplaqinksnvknvkaawsfstgvlnghegaplv
    igdmmyvhsafpnntyalnlndpgkivwqhkpkqdastkavmccdvvdrglaygagqivk
    kqanghllaldaktgkinwevevcdpkvgstltqapfvakdtvlmgcsgaelgvrgavna
    fdlktgelkwrafatgsddsvrlakdfnsanphygqfglgtktwegdawkigggtnwgwy
    aydpklnlfyygsgnpapwnetmrpgdnkwtmtiwgrdldtgmakwgyqktphdewdfag
    vnqmvltdqpvngkmtpllshidrngilytlnrengnlivaekvdpavnvfkkvdlktgt
    pvrdpefatrmdhkgtnicpsamgfhnqgvdsydpesrtlyaglnhicmdwepfmlpyra
    gqffvgatlamypgpngptkkemgqirafdlttgkakwtkwekfaawggtlytkgglvwy
    atldgylkaldnkdgkelwnfkmpsggigspmtysfkgkqyigsmygvggwpgvglvfdl
    tdpsaglgavgafrelqnhtqmggglmvfsl
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4aahD (D:)
    ydgqnckepgncwenkpgypekiagskydpkhdpvelnkqeesikamdarnakrianaks
    sgnfvfdvk