PDB entry 4aa4

View 4aa4 on RCSB PDB site
Description: p38alpha map kinase bound to cmpd 22
Class: transferase
Keywords: serine/threonine kinase, transferase
Deposited on 2011-11-30, released 2012-05-16
The last revision prior to the SCOPe 2.06 freeze date was dated 2012-06-06, with a file datestamp of 2012-06-01.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.21353
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Mitogen-activated protein kinase 14
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4aa4a_
  • Heterogens: QC0, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4aa4A (A:)
    hhhhhhsqerptfyrqelnktiwevperyqnlspvgsgaygsvcaafdtktglrvavkkl
    srpfqsiihakrtyrelrllkhmkhenviglldvftparsleefndvylvthlmgadlnn
    ivkcqkltddhvqfliyqilrglkyihsadiihrdlkpsnlavnedcelkildfglarht
    ddemtgyvatrwyrapeimlnwmhynqtvdiwsvgcimaelltgrtlfpgtdhidqlkli
    lrlvgtpgaellkkissesarnyiqsltqmpkmnfanvfiganplavdllekmlvldsdk
    ritaaqalahayfaqyhdpddepvadpydqsfesrdllidewksltydevisfvpppldq
    eemes
    

    Sequence, based on observed residues (ATOM records): (download)
    >4aa4A (A:)
    rptfyrqelnktiwevperyqnlspvgsgaygsvcaafdtktglrvavkklsrpfqsiih
    akrtyrelrllkhmkhenviglldvftparsleefndvylvthlmgadlnnivltddhvq
    fliyqilrglkyihsadiihrdlkpsnlavnedcelkildfglarhtddemtgyvatrwy
    rapeimlnwmhynqtvdiwsvgcimaelltgrtlfpgtdhidqlklilrlvgtpgaellk
    kissesarnyiqsltqmpkmnfanvfiganplavdllekmlvldsdkritaaqalahayf
    aqyhdpddepvadpydqsfesrdllidewksltydevisfvpppldq