PDB entry 4a8x

View 4a8x on RCSB PDB site
Description: Structure of the core ASAP complex
Class: transcription
Keywords: transcription, splicing, RNA processing, nonsense mediated decay, nmd, hdac, histone deacetylation
Deposited on 2011-11-21, released 2012-03-07
The last revision prior to the SCOPe 2.08 freeze date was dated 2012-04-18, with a file datestamp of 2012-04-13.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.1877
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: RNA-binding protein with serine-rich domain 1
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q15287 (2-87)
      • expression tag (0-1)
    Domains in SCOPe 2.08: d4a8xa1, d4a8xa2
  • Chain 'B':
    Compound: hook-like, isoform a
    Species: DROSOPHILA MELANOGASTER [TaxId:7227]
    Database cross-references and differences (RAF-indexed):
  • Chain 'C':
    Compound: Histone deacetylase complex subunit SAP18
    Species: MUS MUSCULUS [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4a8xA (A:)
    smkptkvhigrltrnvtkdhimeifstygkikmidmpvermhphlskgyayvefenpdea
    ekalkhmdggqidgqeitatavlapwpr
    

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    No sequence available.