PDB entry 4a8v

View 4a8v on RCSB PDB site
Description: Crystal Structure of Birch Pollen Allergen Bet v 1 isoform j in complex with 8-Anilinonaphthalene-1-sulfonate (ANS)
Class: allergen
Keywords: allergen, pr-10 protein
Deposited on 2011-11-21, released 2012-05-30
The last revision prior to the SCOPe 2.08 freeze date was dated 2012-08-15, with a file datestamp of 2012-08-10.
Experiment type: XRAY
Resolution: 1.23 Å
R-factor: 0.13657
AEROSPACI score: 0.82 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: major pollen allergen bet v 1-j
    Species: Betula pendula [TaxId:3505]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d4a8va_
  • Heterogens: 2AN, MPD, SO4, TRS, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4a8vA (A:)
    gvfnyeteatsvipaarlfkafildgdnlfpkvapqaissveniegnggpgtikkisfpe
    gfpfkyvkdrvdevdhtnfkysysvieggpvgdtlekisneikivatpnggsilkinnky
    htkgdhevkaeqikaskemgetllravesyllahsdayn