PDB entry 4a8t

View 4a8t on RCSB PDB site
Description: Crystal structure of putrescine transcarbamylase from Enterococcus faecalis lacking its C-terminal Helix, with bound N5-(phosphonoacetyl) -L-ornithine
Class: transferase
Keywords: transferase, trabnsferase palo, delta-n-(phosphonoacetyl)-l-ornithine, agmatine deiminase route, agmatine catabolism, agmatine fermentation, ornithine, ornithine carbamoyltransferase, arginine deiminase, phosphonoacetylornithine
Deposited on 2011-11-21, released 2012-02-15
The last revision prior to the SCOPe 2.06 freeze date was dated 2012-03-14, with a file datestamp of 2012-03-09.
Experiment type: XRAY
Resolution: 1.59 Å
R-factor: 0.16308
AEROSPACI score: 0.63 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Putrescine carbamoyltransferase
    Species: ENTEROCOCCUS FAECALIS [TaxId:1351]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q837U7 (22-338)
      • expression tag (21)
    Domains in SCOPe 2.06: d4a8ta1, d4a8ta2, d4a8ta3
  • Heterogens: PAO, NI, PGE, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4a8tA (A:)
    mhhhhhhssgvdlgtenlyfqsmkrdyvttetytkeemhylvdlslkikeaikngyypql
    lknkslgmifqqsstrtrvsfetameqlgghgeylapgqiqlgghetiedtsrvlsrlvd
    ilmarverhhsivdlancatipvingmsdynhptqelgdlctmvehlpegkkledckvvf
    vgdatqvcfslglittkmgmnfvhfgpegfqlneehqaklakncevsggsflvtddassv
    egadflytdvwyglyeaelseeermkvfypkyqvnqemmdraganckfmhclpatrgeev
    tdevidgknsicfdeaenrltsirgllvylmndyeaknp
    

    Sequence, based on observed residues (ATOM records): (download)
    >4a8tA (A:)
    smkrdyvttetytkeemhylvdlslkikeaikngyypqllknkslgmifqqsstrtrvsf
    etameqlgghgeylapgiqlgghetiedtsrvlsrlvdilmarverhhsivdlancatip
    vingmsdynhptqelgdlctmvehlpegkkledckvvfvgdatqvcfslglittkmgmnf
    vhfgpegfqlneehqaklakncevsggsflvtddassvegadflytdvwyglyeaelsee
    ermkvfypkyqvnqemmdraganckfmhclpatrgeevtdevidgknsicfdeaenrlts
    irgllvylmndyeaknp