PDB entry 4a84

View 4a84 on RCSB PDB site
Description: Crystal Structure of Major Birch Pollen Allergen Bet v 1 a F30V mutant in complex with deoxycholate.
Class: allergen
Keywords: allergen, pr-10 protein
Deposited on 2011-11-18, released 2012-05-30
The last revision prior to the SCOPe 2.02 freeze date was dated 2012-08-15, with a file datestamp of 2012-08-10.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: 0.16907
AEROSPACI score: 0.64 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: major pollen allergen bet v 1-a
    Species: Betula pendula [TaxId:3505]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P15494 (0-158)
      • engineered mutation (29)
    Domains in SCOPe 2.02: d4a84a_
  • Heterogens: DXC, MPD, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4a84A (A:)
    gvfnyetettsvipaarlfkafildgdnlvpkvapqaissveniegnggpgtikkisfpe
    gfpfkyvkdrvdevdhtnfkynysvieggpigdtlekisneikivatpdggsilkisnky
    htkgdhevkaeqvkaskemgetllravesyllahsdayn