PDB entry 4a7m

View 4a7m on RCSB PDB site
Description: cytochrome c peroxidase S81W mutant
Class: oxidoreductase
Keywords: oxidoreductase, transit peptide, hydrogen peroxide, inh, isoniazid
Deposited on 2011-11-14, released 2012-11-07
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-07-05, with a file datestamp of 2017-06-30.
Experiment type: XRAY
Resolution: 1.71 Å
R-factor: N/A
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Cytochrome c peroxidase, mitochondrial
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00431 (Start-295)
      • engineered mutation (82)
    Domains in SCOPe 2.07: d4a7ma_
  • Heterogens: HEM, MRD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4a7mA (A:)
    mkttplvhvasvekgrsyedfqkvynaialklreddeydnyigygpvlvrlawhtsgtwd
    khdntggsyggtyrfkkefndpwnaglqngfkflepihkefpwissgdlfslggvtavqe
    mqgpkipwrcgrvdtpedttpdngrlpdadkdadyvrtffqrlnmndrevvalmgahalg
    kthlknsgyegpwgaannvftnefylnllnedwklekndanneqwdsksgymmlptdysl
    iqdpkylsivkeyandqdkffkdfskafekllengitfpkdapspfifktleeqgl
    

    Sequence, based on observed residues (ATOM records): (download)
    >4a7mA (A:)
    tplvhvasvekgrsyedfqkvynaialklreddeydnyigygpvlvrlawhtsgtwdkhd
    ntggsyggtyrfkkefndpwnaglqngfkflepihkefpwissgdlfslggvtavqemqg
    pkipwrcgrvdtpedttpdngrlpdadkdadyvrtffqrlnmndrevvalmgahalgkth
    lknsgyegpwgaannvftnefylnllnedwklekndanneqwdsksgymmlptdysliqd
    pkylsivkeyandqdkffkdfskafekllengitfpkdapspfifktleeqgl