PDB entry 4a76

View 4a76 on RCSB PDB site
Description: The Lin28b Cold shock domain in complex with heptathymidine
Class: chaperone/DNA
Keywords: chaperone-DNA complex
Deposited on 2011-11-11, released 2012-09-05
The last revision prior to the SCOPe 2.04 freeze date was dated 2012-09-05, with a file datestamp of 2012-08-31.
Experiment type: XRAY
Resolution: 1.92 Å
R-factor: 0.20925
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: lin28 cold shock domain
    Species: Xenopus (Silurana) tropicalis [TaxId:8364]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d4a76a_
  • Chain 'B':
    Compound: 5'-d(*tp*tp*tp*tp*tp*tp*tp)-3'
    Species:
    Gene:
  • Chain 'C':
    Compound: lin28 cold shock domain
    Species: Xenopus (Silurana) tropicalis [TaxId:8364]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d4a76c_
  • Chain 'D':
    Compound: 5'-d(*tp*tp*tp*tp*tp*tp*tp)-3'
    Species:
    Gene:
  • Chain 'E':
    Compound: lin28 cold shock domain
    Species: Xenopus (Silurana) tropicalis [TaxId:8364]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d4a76e_
  • Chain 'F':
    Compound: 5'-d(*tp*tp*tp*tp*tp*tp*tp)-3'
    Species:
    Gene:
  • Chain 'G':
    Compound: lin28 cold shock domain
    Species: Xenopus (Silurana) tropicalis [TaxId:8364]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot B4F6I0 (2-End)
      • expression tag (1)
    Domains in SCOPe 2.04: d4a76g_
  • Chain 'H':
    Compound: 5'-d(*tp*tp*tp*tp*tp*tp*tp)-3'
    Species:
    Gene:
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4a76A (A:)
    gsdpqvlrgsghckwfnvrmgfgfismtsregsplenpvdvfvhqsklymegfrslkege
    pveftfkksskgfeslrvtgpggnpclgne
    

    Sequence, based on observed residues (ATOM records): (download)
    >4a76A (A:)
    pqvlrgsghckwfnvrmgfgfismtsregsplenpvdvfvhqsklymegfrslkegepve
    ftfkksskgfeslrvtgpggnpclgn
    

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4a76C (C:)
    gsdpqvlrgsghckwfnvrmgfgfismtsregsplenpvdvfvhqsklymegfrslkege
    pveftfkksskgfeslrvtgpggnpclgne
    

    Sequence, based on observed residues (ATOM records): (download)
    >4a76C (C:)
    qvlrgsghckwfnvrmgfgfismtsregsplenpvdvfvhqsklymegfrslkegepvef
    tfkksskgfeslrvtgpggnpclgn
    

  • Chain 'D':
    No sequence available.

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >4a76E (E:)
    gsdpqvlrgsghckwfnvrmgfgfismtsregsplenpvdvfvhqsklymegfrslkege
    pveftfkksskgfeslrvtgpggnpclgne
    

    Sequence, based on observed residues (ATOM records): (download)
    >4a76E (E:)
    dpqvlrgsghckwfnvrmgfgfismtsregsplenpvdvfvhqsklymegfrslkegepv
    eftfkksskgfeslrvtgpggnpclgn
    

  • Chain 'F':
    No sequence available.

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >4a76G (G:)
    gsdpqvlrgsghckwfnvrmgfgfismtsregsplenpvdvfvhqsklymegfrslkege
    pveftfkksskgfeslrvtgpggnpclgne
    

    Sequence, based on observed residues (ATOM records): (download)
    >4a76G (G:)
    sdpqvlrgsghckwfnvrmgfgfismtsregsplenpvdvfvhqsklymegfrslkegep
    veftfkksskgfeslrvtgpggnpclgn
    

  • Chain 'H':
    No sequence available.