PDB entry 4a6l

View 4a6l on RCSB PDB site
Description: beta-tryptase inhibitor
Class: hydrolase
Keywords: hydrolase, inhibitor
Deposited on 2011-11-04, released 2012-01-25
The last revision prior to the SCOPe 2.01 freeze date was dated 2012-01-25, with a file datestamp of 2012-01-20.
Experiment type: XRAY
Resolution: 2.05 Å
R-factor: 0.1896
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: tryptase alpha/beta-1
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q15661 (0-End)
      • conflict (101)
    Domains in SCOPe 2.01: d4a6la_
  • Chain 'B':
    Compound: tryptase alpha/beta-1
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q15661 (0-End)
      • conflict (101)
    Domains in SCOPe 2.01: d4a6lb_
  • Chain 'C':
    Compound: tryptase alpha/beta-1
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q15661 (0-End)
      • conflict (101)
    Domains in SCOPe 2.01: d4a6lc_
  • Chain 'D':
    Compound: tryptase alpha/beta-1
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q15661 (0-End)
      • conflict (101)
    Domains in SCOPe 2.01: d4a6ld_
  • Heterogens: P43, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4a6lA (A:)
    ivggqeaprskwpwqvslrvhgpywmhfcggslihpqwvltaahcvgpdvkdlaalrvql
    reqhlyyqdqllpvsriivhpqfytaqigadialleleepvkvsshvhtvtlppasetfp
    pgmpcwvtgwgdvdnderlpppfplkqvkvpimenhicdakyhlgaytgddvrivrddml
    cagntrrdscqgdsggplvckvngtwlqagvvswgegcaqpnrpgiytrvtyyldwihhy
    vpkkp
    

    Sequence, based on observed residues (ATOM records): (download)
    >4a6lA (A:)
    ivggqeaprskwpwqvslrvhgpywmhfcggslihpqwvltaahcvgpdvkdlaalrvql
    reqhlyyqdqllpvsriivhpqfytaqigadialleleepvkvsshvhtvtlppasetfp
    pgmpcwvtgwgdvdnderlpppfplkqvkvpimenhicdakyhlgaytgddvrivrddml
    cagntrrdscqgdsggplvckvngtwlqagvvswgegcaqpnrpgiytrvtyyldwihhy
    vpk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4a6lB (B:)
    ivggqeaprskwpwqvslrvhgpywmhfcggslihpqwvltaahcvgpdvkdlaalrvql
    reqhlyyqdqllpvsriivhpqfytaqigadialleleepvkvsshvhtvtlppasetfp
    pgmpcwvtgwgdvdnderlpppfplkqvkvpimenhicdakyhlgaytgddvrivrddml
    cagntrrdscqgdsggplvckvngtwlqagvvswgegcaqpnrpgiytrvtyyldwihhy
    vpkkp
    

    Sequence, based on observed residues (ATOM records): (download)
    >4a6lB (B:)
    ivggqeaprskwpwqvslrvhgpywmhfcggslihpqwvltaahcvgpdvkdlaalrvql
    reqhlyyqdqllpvsriivhpqfytaqigadialleleepvkvsshvhtvtlppasetfp
    pgmpcwvtgwgdvdnderlpppfplkqvkvpimenhicdakyhlgaytgddvrivrddml
    cagntrrdscqgdsggplvckvngtwlqagvvswgegcaqpnrpgiytrvtyyldwihhy
    vpk
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4a6lC (C:)
    ivggqeaprskwpwqvslrvhgpywmhfcggslihpqwvltaahcvgpdvkdlaalrvql
    reqhlyyqdqllpvsriivhpqfytaqigadialleleepvkvsshvhtvtlppasetfp
    pgmpcwvtgwgdvdnderlpppfplkqvkvpimenhicdakyhlgaytgddvrivrddml
    cagntrrdscqgdsggplvckvngtwlqagvvswgegcaqpnrpgiytrvtyyldwihhy
    vpkkp
    

    Sequence, based on observed residues (ATOM records): (download)
    >4a6lC (C:)
    ivggqeaprskwpwqvslrvhgpywmhfcggslihpqwvltaahcvgpdvkdlaalrvql
    reqhlyyqdqllpvsriivhpqfytaqigadialleleepvkvsshvhtvtlppasetfp
    pgmpcwvtgwgdvdnderlpppfplkqvkvpimenhicdakyhlgaytgddvrivrddml
    cagntrrdscqgdsggplvckvngtwlqagvvswgegcaqpnrpgiytrvtyyldwihhy
    vpk
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >4a6lD (D:)
    ivggqeaprskwpwqvslrvhgpywmhfcggslihpqwvltaahcvgpdvkdlaalrvql
    reqhlyyqdqllpvsriivhpqfytaqigadialleleepvkvsshvhtvtlppasetfp
    pgmpcwvtgwgdvdnderlpppfplkqvkvpimenhicdakyhlgaytgddvrivrddml
    cagntrrdscqgdsggplvckvngtwlqagvvswgegcaqpnrpgiytrvtyyldwihhy
    vpkkp
    

    Sequence, based on observed residues (ATOM records): (download)
    >4a6lD (D:)
    ivggqeaprskwpwqvslrvhgpywmhfcggslihpqwvltaahcvgpdvkdlaalrvql
    reqhlyyqdqllpvsriivhpqfytaqigadialleleepvkvsshvhtvtlppasetfp
    pgmpcwvtgwgdvdnderlpppfplkqvkvpimenhicdakyhlgaytgddvrivrddml
    cagntrrdscqgdsggplvckvngtwlqagvvswgegcaqpnrpgiytrvtyyldwihhy
    vpk