PDB entry 4a6a

View 4a6a on RCSB PDB site
Description: A115V variant of dCTP deaminase-dUTPase from Mycobacterium tuberculosis in complex with dTTP
Class: hydrolase
Keywords: hydrolase, deoxy-ribonucleotide metabolism, dttp inhibition
Deposited on 2011-11-01, released 2012-10-10
The last revision prior to the SCOPe 2.06 freeze date was dated 2012-12-26, with a file datestamp of 2012-12-21.
Experiment type: XRAY
Resolution: 2.9 Å
R-factor: 0.25478
AEROSPACI score: 0.21 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: deoxycytidine triphosphate deaminase
    Species: Mycobacterium tuberculosis [TaxId:83332]
    Database cross-references and differences (RAF-indexed):
    • Uniprot O07247 (0-End)
      • engineered mutation (114)
    Domains in SCOPe 2.06: d4a6aa_
  • Chain 'B':
    Compound: deoxycytidine triphosphate deaminase
    Species: Mycobacterium tuberculosis [TaxId:83332]
    Database cross-references and differences (RAF-indexed):
    • Uniprot O07247 (0-End)
      • engineered mutation (114)
    Domains in SCOPe 2.06: d4a6ab_
  • Chain 'C':
    Compound: deoxycytidine triphosphate deaminase
    Species: Mycobacterium tuberculosis [TaxId:83332]
    Database cross-references and differences (RAF-indexed):
    • Uniprot O07247 (0-End)
      • engineered mutation (114)
    Domains in SCOPe 2.06: d4a6ac_
  • Chain 'D':
    Compound: deoxycytidine triphosphate deaminase
    Species: Mycobacterium tuberculosis [TaxId:83332]
    Database cross-references and differences (RAF-indexed):
    • Uniprot O07247 (0-End)
      • engineered mutation (114)
    Domains in SCOPe 2.06: d4a6ad_
  • Chain 'E':
    Compound: deoxycytidine triphosphate deaminase
    Species: Mycobacterium tuberculosis [TaxId:83332]
    Database cross-references and differences (RAF-indexed):
    • Uniprot O07247 (0-End)
      • engineered mutation (114)
    Domains in SCOPe 2.06: d4a6ae_
  • Chain 'F':
    Compound: deoxycytidine triphosphate deaminase
    Species: Mycobacterium tuberculosis [TaxId:83332]
    Database cross-references and differences (RAF-indexed):
    • Uniprot O07247 (0-End)
      • engineered mutation (114)
    Domains in SCOPe 2.06: d4a6af_
  • Chain 'G':
    Compound: deoxycytidine triphosphate deaminase
    Species: Mycobacterium tuberculosis [TaxId:83332]
    Database cross-references and differences (RAF-indexed):
    • Uniprot O07247 (0-End)
      • engineered mutation (114)
    Domains in SCOPe 2.06: d4a6ag_
  • Chain 'H':
    Compound: deoxycytidine triphosphate deaminase
    Species: Mycobacterium tuberculosis [TaxId:83332]
    Database cross-references and differences (RAF-indexed):
    • Uniprot O07247 (0-End)
      • engineered mutation (114)
    Domains in SCOPe 2.06: d4a6ah_
  • Chain 'I':
    Compound: deoxycytidine triphosphate deaminase
    Species: Mycobacterium tuberculosis [TaxId:83332]
    Database cross-references and differences (RAF-indexed):
    • Uniprot O07247 (0-End)
      • engineered mutation (114)
    Domains in SCOPe 2.06: d4a6ai_
  • Chain 'J':
    Compound: deoxycytidine triphosphate deaminase
    Species: Mycobacterium tuberculosis [TaxId:83332]
    Database cross-references and differences (RAF-indexed):
    • Uniprot O07247 (0-End)
      • engineered mutation (114)
    Domains in SCOPe 2.06: d4a6aj_
  • Chain 'K':
    Compound: deoxycytidine triphosphate deaminase
    Species: Mycobacterium tuberculosis [TaxId:83332]
    Database cross-references and differences (RAF-indexed):
    • Uniprot O07247 (0-End)
      • engineered mutation (114)
    Domains in SCOPe 2.06: d4a6ak_
  • Chain 'L':
    Compound: deoxycytidine triphosphate deaminase
    Species: Mycobacterium tuberculosis [TaxId:83332]
    Database cross-references and differences (RAF-indexed):
    • Uniprot O07247 (0-End)
      • engineered mutation (114)
    Domains in SCOPe 2.06: d4a6al_
  • Heterogens: TTP, MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4a6aA (A:)
    mllsdrdlraeissgrlgidpfddtlvqpssidvrldclfrvfnntrythidpakqqdel
    tslvqpvdgepfvlhpgefvlgstlelftlpdnlagrlegksslgrlgllthstvgfidp
    gfsghitlelsnvanlpitlwpgmkigqlcmlrltspsehpygssragskyqgqrgptps
    rsyqnfirst
    

    Sequence, based on observed residues (ATOM records): (download)
    >4a6aA (A:)
    mllsdrdlraeissgrlgidpfddtlvqpssidvrldclfrvfnntrythidpakqqdel
    tslvqpvdgepfvlhpgefvlgstlelftlpdnlagrlegksslgrlgllthstvgfidp
    gfsghitlelsnvanlpitlwpgmkigqlcmlrltspsehpygssragskyqgqrgptps
    rsyqnfirs
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4a6aB (B:)
    mllsdrdlraeissgrlgidpfddtlvqpssidvrldclfrvfnntrythidpakqqdel
    tslvqpvdgepfvlhpgefvlgstlelftlpdnlagrlegksslgrlgllthstvgfidp
    gfsghitlelsnvanlpitlwpgmkigqlcmlrltspsehpygssragskyqgqrgptps
    rsyqnfirst
    

    Sequence, based on observed residues (ATOM records): (download)
    >4a6aB (B:)
    mllsdrdlraeissgrlgidpfddtlvqpssidvrldclfrvfnntrythidpakqqdel
    tslvqpvdgepfvlhpgefvlgstlelftlpdnlagrlegksslgrlgllthstvgfidp
    gfsghitlelsnvanlpitlwpgmkigqlcmlrltspsehpygssragskyqgqrgptps
    rsyqnfir
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4a6aC (C:)
    mllsdrdlraeissgrlgidpfddtlvqpssidvrldclfrvfnntrythidpakqqdel
    tslvqpvdgepfvlhpgefvlgstlelftlpdnlagrlegksslgrlgllthstvgfidp
    gfsghitlelsnvanlpitlwpgmkigqlcmlrltspsehpygssragskyqgqrgptps
    rsyqnfirst
    

    Sequence, based on observed residues (ATOM records): (download)
    >4a6aC (C:)
    mllsdrdlraeissgrlgidpfddtlvqpssidvrldclfrvfnntrythidpakqqdel
    tslvqpvdgepfvlhpgefvlgstlelftlpdnlagrlegksslgrlgllthstvgfidp
    gfsghitlelsnvanlpitlwpgmkigqlcmlrltspsehpygssragskyqgqrgptps
    rsyqnfirs
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >4a6aD (D:)
    mllsdrdlraeissgrlgidpfddtlvqpssidvrldclfrvfnntrythidpakqqdel
    tslvqpvdgepfvlhpgefvlgstlelftlpdnlagrlegksslgrlgllthstvgfidp
    gfsghitlelsnvanlpitlwpgmkigqlcmlrltspsehpygssragskyqgqrgptps
    rsyqnfirst
    

    Sequence, based on observed residues (ATOM records): (download)
    >4a6aD (D:)
    mllsdrdlraeissgrlgidpfddtlvqpssidvrldclfrvfnntrythidpakqqdel
    tslvqpvdgepfvlhpgefvlgstlelftlpdnlagrlegksslgrlgllthstvgfidp
    gfsghitlelsnvanlpitlwpgmkigqlcmlrltspsehpygssragskyqgqrgptps
    rsyqnfir
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >4a6aE (E:)
    mllsdrdlraeissgrlgidpfddtlvqpssidvrldclfrvfnntrythidpakqqdel
    tslvqpvdgepfvlhpgefvlgstlelftlpdnlagrlegksslgrlgllthstvgfidp
    gfsghitlelsnvanlpitlwpgmkigqlcmlrltspsehpygssragskyqgqrgptps
    rsyqnfirst
    

    Sequence, based on observed residues (ATOM records): (download)
    >4a6aE (E:)
    mllsdrdlraeissgrlgidpfddtlvqpssidvrldclfrvfnntrythidpakqqdel
    tslvqpvdgepfvlhpgefvlgstlelftlpdnlagrlegksslgrlgllthstvgfidp
    gfsghitlelsnvanlpitlwpgmkigqlcmlrltspsehpygssragskyqgqrgptps
    rsyqnfir
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >4a6aF (F:)
    mllsdrdlraeissgrlgidpfddtlvqpssidvrldclfrvfnntrythidpakqqdel
    tslvqpvdgepfvlhpgefvlgstlelftlpdnlagrlegksslgrlgllthstvgfidp
    gfsghitlelsnvanlpitlwpgmkigqlcmlrltspsehpygssragskyqgqrgptps
    rsyqnfirst
    

    Sequence, based on observed residues (ATOM records): (download)
    >4a6aF (F:)
    mllsdrdlraeissgrlgidpfddtlvqpssidvrldclfrvfnntrythidpakqqdel
    tslvqpvdgepfvlhpgefvlgstlelftlpdnlagrlegksslgrlgllthstvgfidp
    gfsghitlelsnvanlpitlwpgmkigqlcmlrltspsehpygssragskyqgqrgptps
    rsyqnfirs
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >4a6aG (G:)
    mllsdrdlraeissgrlgidpfddtlvqpssidvrldclfrvfnntrythidpakqqdel
    tslvqpvdgepfvlhpgefvlgstlelftlpdnlagrlegksslgrlgllthstvgfidp
    gfsghitlelsnvanlpitlwpgmkigqlcmlrltspsehpygssragskyqgqrgptps
    rsyqnfirst
    

    Sequence, based on observed residues (ATOM records): (download)
    >4a6aG (G:)
    mllsdrdlraeissgrlgidpfddtlvqpssidvrldclfrvfnntrythidpakqqdel
    tslvqpvdgepfvlhpgefvlgstlelftlpdnlagrlegksslgrlgllthstvgfidp
    gfsghitlelsnvanlpitlwpgmkigqlcmlrltspsehpygssragskyqgqrgptps
    rsyqnfirs
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >4a6aH (H:)
    mllsdrdlraeissgrlgidpfddtlvqpssidvrldclfrvfnntrythidpakqqdel
    tslvqpvdgepfvlhpgefvlgstlelftlpdnlagrlegksslgrlgllthstvgfidp
    gfsghitlelsnvanlpitlwpgmkigqlcmlrltspsehpygssragskyqgqrgptps
    rsyqnfirst
    

    Sequence, based on observed residues (ATOM records): (download)
    >4a6aH (H:)
    mllsdrdlraeissgrlgidpfddtlvqpssidvrldclfrvfnntrythidpakqqdel
    tslvqpvdgepfvlhpgefvlgstlelftlpdnlagrlegksslgrlgllthstvgfidp
    gfsghitlelsnvanlpitlwpgmkigqlcmlrltspsehpygssragskyqgqrgptps
    rsyqnfirs
    

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >4a6aI (I:)
    mllsdrdlraeissgrlgidpfddtlvqpssidvrldclfrvfnntrythidpakqqdel
    tslvqpvdgepfvlhpgefvlgstlelftlpdnlagrlegksslgrlgllthstvgfidp
    gfsghitlelsnvanlpitlwpgmkigqlcmlrltspsehpygssragskyqgqrgptps
    rsyqnfirst
    

    Sequence, based on observed residues (ATOM records): (download)
    >4a6aI (I:)
    mllsdrdlraeissgrlgidpfddtlvqpssidvrldclfrvfnntrythidpakqqdel
    tslvqpvdgepfvlhpgefvlgstlelftlpdnlagrlegksslgrlgllthstvgfidp
    gfsghitlelsnvanlpitlwpgmkigqlcmlrltspsehpygssragskyqgqrgptps
    rsyqnfirs
    

  • Chain 'J':
    Sequence, based on SEQRES records: (download)
    >4a6aJ (J:)
    mllsdrdlraeissgrlgidpfddtlvqpssidvrldclfrvfnntrythidpakqqdel
    tslvqpvdgepfvlhpgefvlgstlelftlpdnlagrlegksslgrlgllthstvgfidp
    gfsghitlelsnvanlpitlwpgmkigqlcmlrltspsehpygssragskyqgqrgptps
    rsyqnfirst
    

    Sequence, based on observed residues (ATOM records): (download)
    >4a6aJ (J:)
    mllsdrdlraeissgrlgidpfddtlvqpssidvrldclfrvfnntrythidpakqqdel
    tslvqpvdgepfvlhpgefvlgstlelftlpdnlagrlegksslgrlgllthstvgfidp
    gfsghitlelsnvanlpitlwpgmkigqlcmlrltspsehpygssragskyqgqrgptps
    rsyqnfir
    

  • Chain 'K':
    Sequence, based on SEQRES records: (download)
    >4a6aK (K:)
    mllsdrdlraeissgrlgidpfddtlvqpssidvrldclfrvfnntrythidpakqqdel
    tslvqpvdgepfvlhpgefvlgstlelftlpdnlagrlegksslgrlgllthstvgfidp
    gfsghitlelsnvanlpitlwpgmkigqlcmlrltspsehpygssragskyqgqrgptps
    rsyqnfirst
    

    Sequence, based on observed residues (ATOM records): (download)
    >4a6aK (K:)
    mllsdrdlraeissgrlgidpfddtlvqpssidvrldclfrvfnntrythidpakqqdel
    tslvqpvdgepfvlhpgefvlgstlelftlpdnlagrlegksslgrlgllthstvgfidp
    gfsghitlelsnvanlpitlwpgmkigqlcmlrltspsehpygssragskyqgqrgptps
    rsyqnfir
    

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >4a6aL (L:)
    mllsdrdlraeissgrlgidpfddtlvqpssidvrldclfrvfnntrythidpakqqdel
    tslvqpvdgepfvlhpgefvlgstlelftlpdnlagrlegksslgrlgllthstvgfidp
    gfsghitlelsnvanlpitlwpgmkigqlcmlrltspsehpygssragskyqgqrgptps
    rsyqnfirst
    

    Sequence, based on observed residues (ATOM records): (download)
    >4a6aL (L:)
    mllsdrdlraeissgrlgidpfddtlvqpssidvrldclfrvfnntrythidpakqqdel
    tslvqpvdgepfvlhpgefvlgstlelftlpdnlagrlegksslgrlgllthstvgfidp
    gfsghitlelsnvanlpitlwpgmkigqlcmlrltspsehpygssragskyqgqrgptps
    rsyqnfirs