PDB entry 4a69

View 4a69 on RCSB PDB site
Description: Structure of HDAC3 bound to corepressor and inositol tetraphosphate
Class: transcription
Keywords: transcription, hydrolase
Deposited on 2011-11-01, released 2012-01-11
The last revision prior to the SCOPe 2.04 freeze date was dated 2012-01-25, with a file datestamp of 2012-01-20.
Experiment type: XRAY
Resolution: 2.06 Å
R-factor: 0.18955
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: histone deacetylase 3,
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: histone deacetylase 3,
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
  • Chain 'C':
    Compound: Nuclear receptor corepressor 2
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d4a69c_
  • Chain 'D':
    Compound: Nuclear receptor corepressor 2
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d4a69d_
  • Heterogens: ZN, ACT, K, GOL, I0P, HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4a69C (C:)
    gamrqlavippmlydadqqrikfinmnglmadpmkvykdrqvmnmwseqeketfrekfmq
    hpknfgliasflerktvaecvlyyyltkknenyk
    

    Sequence, based on observed residues (ATOM records): (download)
    >4a69C (C:)
    kfinmnglmadpmkvykdrqvmnmwseqeketfrekfmqhpknfgliasflerktvaecv
    lyyyltkkn
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >4a69D (D:)
    gamrqlavippmlydadqqrikfinmnglmadpmkvykdrqvmnmwseqeketfrekfmq
    hpknfgliasflerktvaecvlyyyltkknenyk
    

    Sequence, based on observed residues (ATOM records): (download)
    >4a69D (D:)
    kfinmnglmadpmkvykdrqvmnmwseqeketfrekfmqhpknfgliasflerktvaecv
    lyyyltkk