PDB entry 4a63

View 4a63 on RCSB PDB site
Description: Crystal structure of the p73-ASPP2 complex at 2.6A resolution
Class: cell cycle
Keywords: cell cycle, tp53bp2, tumour suppressor, ankyrins, apoptosis regulatory proteins
Deposited on 2011-10-31, released 2011-12-21
The last revision prior to the SCOPe 2.07 freeze date was dated 2012-10-31, with a file datestamp of 2012-10-26.
Experiment type: XRAY
Resolution: 2.27 Å
R-factor: 0.2166
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: tumour protein 73
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot O15350 (Start-200)
      • expression tag (201-207)
    Domains in SCOPe 2.07: d4a63a1, d4a63a2
  • Chain 'B':
    Compound: apoptosis stimulating of p53 protein 2
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4a63b1, d4a63b2
  • Chain 'C':
    Compound: tumour protein 73
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot O15350 (Start-200)
      • expression tag (201-207)
    Domains in SCOPe 2.07: d4a63c1, d4a63c2
  • Chain 'D':
    Compound: apoptosis stimulating of p53 protein 2
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4a63d1, d4a63d2
  • Chain 'E':
    Compound: tumour protein 73
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot O15350 (Start-200)
      • expression tag (201-207)
    Domains in SCOPe 2.07: d4a63e1, d4a63e2
  • Chain 'F':
    Compound: apoptosis stimulating of p53 protein 2
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4a63f1, d4a63f2
  • Chain 'G':
    Compound: tumour protein 73
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot O15350 (Start-200)
      • expression tag (201-207)
    Domains in SCOPe 2.07: d4a63g1, d4a63g2
  • Chain 'H':
    Compound: apoptosis stimulating of p53 protein 2
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4a63h1, d4a63h2
  • Chain 'I':
    Compound: tumour protein 73
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot O15350 (Start-200)
      • expression tag (201-207)
    Domains in SCOPe 2.07: d4a63i1, d4a63i2
  • Chain 'J':
    Compound: apoptosis stimulating of p53 protein 2
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4a63j1, d4a63j2
  • Chain 'K':
    Compound: tumour protein 73
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot O15350 (Start-200)
      • expression tag (201-207)
    Domains in SCOPe 2.07: d4a63k1, d4a63k2
  • Chain 'L':
    Compound: apoptosis stimulating of p53 protein 2
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4a63l1, d4a63l2
  • Heterogens: ZN, ACT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4a63A (A:)
    mapvipsntdypgphhfevtfqqsstaksatwtyspllkklycqiaktcpiqikvstppp
    pgtairampvykkaehvtdvvkrcpnhelgrdfnegqsapashlirvegnnlsqyvddpv
    tgrqsvvvpyeppqvgtefttilynfmcnsscvggmnrrpiliiitlemrdgqvlgrrsf
    egricacpgrdrkadedhyreaenlyfq
    

    Sequence, based on observed residues (ATOM records): (download)
    >4a63A (A:)
    vipsntdypgphhfevtfqqsstaksatwtyspllkklycqiaktcpiqikvstppppgt
    airampvykkaehvtdvvkrcpnhelgrdfnegqsapashlirvegnnlsqyvddpvtgr
    qsvvvpyeppqvgtefttilynfmcnsscvggmnrrpiliiitlemrdgqvlgrrsfegr
    icacpgrdrkadedhyreaenlyfq
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4a63B (B:)
    smpeitgqvslppgkrtnlrktgseriahgmrvkfnplallldsslegefdlvqriiyev
    ddpslpndegitalhnavcaghteivkflvqfgvnvnaadsdgwtplhcaascnnvqvck
    flvesgaavfamtysdmqtaadkceemeegytqcsqflygvqekmgimnkgviyalwdye
    pqnddelpmkegdcmtiihrededeiewwwarlndkegyvprnllglyprikprqrsla
    

    Sequence, based on observed residues (ATOM records): (download)
    >4a63B (B:)
    mrvkfnplallldsslegefdlvqriiyevddpslpndegitalhnavcaghteivkflv
    qfgvnvnaadsdgwtplhcaascnnvqvckflvesgaavfamtysdmqtaadkceemeeg
    ytqcsqflygvqekmgimnkgviyalwdyepqnddelpmkegdcmtiihrededeiewww
    arlndkegyvprnllglyprik
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4a63C (C:)
    mapvipsntdypgphhfevtfqqsstaksatwtyspllkklycqiaktcpiqikvstppp
    pgtairampvykkaehvtdvvkrcpnhelgrdfnegqsapashlirvegnnlsqyvddpv
    tgrqsvvvpyeppqvgtefttilynfmcnsscvggmnrrpiliiitlemrdgqvlgrrsf
    egricacpgrdrkadedhyreaenlyfq
    

    Sequence, based on observed residues (ATOM records): (download)
    >4a63C (C:)
    vipsntdypgphhfevtfqqsstaksatwtyspllkklycqiaktcpiqikvstppppgt
    airampvykkaehvtdvvkrcpnhelgrdfnegqsapashlirvegnnlsqyvddpvtgr
    qsvvvpyeppqvgtefttilynfmcnsscvggmnrrpiliiitlemrdgqvlgrrsfegr
    icacpgrdrkadedhyreaenlyfq
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >4a63D (D:)
    smpeitgqvslppgkrtnlrktgseriahgmrvkfnplallldsslegefdlvqriiyev
    ddpslpndegitalhnavcaghteivkflvqfgvnvnaadsdgwtplhcaascnnvqvck
    flvesgaavfamtysdmqtaadkceemeegytqcsqflygvqekmgimnkgviyalwdye
    pqnddelpmkegdcmtiihrededeiewwwarlndkegyvprnllglyprikprqrsla
    

    Sequence, based on observed residues (ATOM records): (download)
    >4a63D (D:)
    nplallldsslegefdlvqriiyevddpslpndegitalhnavcaghteivkflvqfgvn
    vnaadsdgwtplhcaascnnvqvckflvesgaavfamtysdmqtaadkceemeegytqcs
    qflygvqekmgimnkgviyalwdyepqnddelpmkegdcmtiihrededeiewwwarlnd
    kegyvprnllglypri
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >4a63E (E:)
    mapvipsntdypgphhfevtfqqsstaksatwtyspllkklycqiaktcpiqikvstppp
    pgtairampvykkaehvtdvvkrcpnhelgrdfnegqsapashlirvegnnlsqyvddpv
    tgrqsvvvpyeppqvgtefttilynfmcnsscvggmnrrpiliiitlemrdgqvlgrrsf
    egricacpgrdrkadedhyreaenlyfq
    

    Sequence, based on observed residues (ATOM records): (download)
    >4a63E (E:)
    vipsntdypgphhfevtfqqsstaksatwtyspllkklycqiaktcpiqikvstppppgt
    airampvykkaehvtdvvkrcpnhelgrdfnegqsapashlirvegnnlsqyvddpvtgr
    qsvvvpyeppqvgtefttilynfmcnsscvggmnrrpiliiitlemrdgqvlgrrsfegr
    icacpgrdrkadedhyreaenlyfq
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >4a63F (F:)
    smpeitgqvslppgkrtnlrktgseriahgmrvkfnplallldsslegefdlvqriiyev
    ddpslpndegitalhnavcaghteivkflvqfgvnvnaadsdgwtplhcaascnnvqvck
    flvesgaavfamtysdmqtaadkceemeegytqcsqflygvqekmgimnkgviyalwdye
    pqnddelpmkegdcmtiihrededeiewwwarlndkegyvprnllglyprikprqrsla
    

    Sequence, based on observed residues (ATOM records): (download)
    >4a63F (F:)
    nplallldsslegefdlvqriiyevddpslpndegitalhnavcaghteivkflvqfgvn
    vnaadsdgwtplhcaascnnvqvckflvesgaavfamtysdmqtaadkceemeegytqcs
    qflygvqekmgimnkgviyalwdyepqnddelpmkegdcmtiihrededeiewwwarlnd
    kegyvprnllglyprik
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >4a63G (G:)
    mapvipsntdypgphhfevtfqqsstaksatwtyspllkklycqiaktcpiqikvstppp
    pgtairampvykkaehvtdvvkrcpnhelgrdfnegqsapashlirvegnnlsqyvddpv
    tgrqsvvvpyeppqvgtefttilynfmcnsscvggmnrrpiliiitlemrdgqvlgrrsf
    egricacpgrdrkadedhyreaenlyfq
    

    Sequence, based on observed residues (ATOM records): (download)
    >4a63G (G:)
    vipsntdypgphhfevtfqqsstaksatwtyspllkklycqiaktcpiqikvstppppgt
    airampvykkaehvtdvvkrcpnhelgrdfnegqsapashlirvegnnlsqyvddpvtgr
    qsvvvpyeppqvgtefttilynfmcnsscvggmnrrpiliiitlemrdgqvlgrrsfegr
    icacpgrdrkadedhyreaenlyfq
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >4a63H (H:)
    smpeitgqvslppgkrtnlrktgseriahgmrvkfnplallldsslegefdlvqriiyev
    ddpslpndegitalhnavcaghteivkflvqfgvnvnaadsdgwtplhcaascnnvqvck
    flvesgaavfamtysdmqtaadkceemeegytqcsqflygvqekmgimnkgviyalwdye
    pqnddelpmkegdcmtiihrededeiewwwarlndkegyvprnllglyprikprqrsla
    

    Sequence, based on observed residues (ATOM records): (download)
    >4a63H (H:)
    kfnplallldsslegefdlvqriiyevddpslpndegitalhnavcaghteivkflvqfg
    vnvnaadsdgwtplhcaascnnvqvckflvesgaavfamtysdmqtaadkceemeegytq
    csqflygvqekmgimnkgviyalwdyepqnddelpmkegdcmtiihrededeiewwwarl
    ndkegyvprnllglypri
    

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >4a63I (I:)
    mapvipsntdypgphhfevtfqqsstaksatwtyspllkklycqiaktcpiqikvstppp
    pgtairampvykkaehvtdvvkrcpnhelgrdfnegqsapashlirvegnnlsqyvddpv
    tgrqsvvvpyeppqvgtefttilynfmcnsscvggmnrrpiliiitlemrdgqvlgrrsf
    egricacpgrdrkadedhyreaenlyfq
    

    Sequence, based on observed residues (ATOM records): (download)
    >4a63I (I:)
    vipsntdypgphhfevtfqqsstaksatwtyspllkklycqiaktcpiqikvstppppgt
    airampvykkaehvtdvvkrcpnhelgrdfnegqsapashlirvegnnlsqyvddpvtgr
    qsvvvpyeppqvgtefttilynfmcnsscvggmnrrpiliiitlemrdgqvlgrrsfegr
    icacpgrdrkadedhyreaenlyfq
    

  • Chain 'J':
    Sequence, based on SEQRES records: (download)
    >4a63J (J:)
    smpeitgqvslppgkrtnlrktgseriahgmrvkfnplallldsslegefdlvqriiyev
    ddpslpndegitalhnavcaghteivkflvqfgvnvnaadsdgwtplhcaascnnvqvck
    flvesgaavfamtysdmqtaadkceemeegytqcsqflygvqekmgimnkgviyalwdye
    pqnddelpmkegdcmtiihrededeiewwwarlndkegyvprnllglyprikprqrsla
    

    Sequence, based on observed residues (ATOM records): (download)
    >4a63J (J:)
    kfnplallldsslegefdlvqriiyevddpslpndegitalhnavcaghteivkflvqfg
    vnvnaadsdgwtplhcaascnnvqvckflvesgaavfamtysdmqtaadkceemeegytq
    csqflygvqekmgimnkgviyalwdyepqnddelpmkegdcmtiihrededeiewwwarl
    ndkegyvprnllglyprikp
    

  • Chain 'K':
    Sequence, based on SEQRES records: (download)
    >4a63K (K:)
    mapvipsntdypgphhfevtfqqsstaksatwtyspllkklycqiaktcpiqikvstppp
    pgtairampvykkaehvtdvvkrcpnhelgrdfnegqsapashlirvegnnlsqyvddpv
    tgrqsvvvpyeppqvgtefttilynfmcnsscvggmnrrpiliiitlemrdgqvlgrrsf
    egricacpgrdrkadedhyreaenlyfq
    

    Sequence, based on observed residues (ATOM records): (download)
    >4a63K (K:)
    vipsntdypgphhfevtfqqsstaksatwtyspllkklycqiaktcpiqikvstppppgt
    airampvykkaehvtdvvkrcpnhelgrdfnegqsapashlirvegnnlsqyvddpvtgr
    qsvvvpyeppqvgtefttilynfmcnsscvggmnrrpiliiitlemrdgqvlgrrsfegr
    icacpgrdrkadedhyreaenlyfq
    

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >4a63L (L:)
    smpeitgqvslppgkrtnlrktgseriahgmrvkfnplallldsslegefdlvqriiyev
    ddpslpndegitalhnavcaghteivkflvqfgvnvnaadsdgwtplhcaascnnvqvck
    flvesgaavfamtysdmqtaadkceemeegytqcsqflygvqekmgimnkgviyalwdye
    pqnddelpmkegdcmtiihrededeiewwwarlndkegyvprnllglyprikprqrsla
    

    Sequence, based on observed residues (ATOM records): (download)
    >4a63L (L:)
    nplallldsslegefdlvqriiyevddpslpndegitalhnavcaghteivkflvqfgvn
    vnaadsdgwtplhcaascnnvqvckflvesgaavfamtysdmqtaadkceemeegytqcs
    qflygvqekmgimnkgviyalwdyepqnddelpmkegdcmtiihrededeiewwwarlnd
    kegyvprnllglypri