PDB entry 4a5y

View 4a5y on RCSB PDB site
Description: Intermediate state of human kinesin Eg5 in complex with Ispinesib
Class: motor protein
Keywords: motor protein, mitosis
Deposited on 2011-10-29, released 2012-11-07
The last revision prior to the SCOPe 2.08 freeze date was dated 2015-05-20, with a file datestamp of 2015-05-15.
Experiment type: XRAY
Resolution: 2.45 Å
R-factor: N/A
AEROSPACI score: 0.21 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Kinesin-like protein KIF11
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d4a5ya_
  • Chain 'B':
    Compound: Kinesin-like protein KIF11
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d4a5yb_
  • Chain 'C':
    Compound: Kinesin-like protein KIF11
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d4a5yc_
  • Heterogens: ADP, CL, G7X, MG, PO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4a5yA (A:)
    masqpnssakkkeekgkniqvvvrcrpfnlaerkasahsivecdpvrkevsvrtggladk
    ssrktytfdmvfgastkqidvyrsvvcpildevimgynctifaygqtgtgktftmegers
    pneeytweedplagiiprtlhqifekltdngtefsvkvslleiyneelfdllnpssdvse
    rlqmfddprnkrgviikgleeitvhnkdevyqilekgaakrttaatlmnayssrshsvfs
    vtihmkettidgeelvkigklnlvdlagsenigrsgavdkrareagninqslltlgrvit
    alvertphvpyreskltrilqdslggrtrtsiiatispaslnleetlstleyahraknil
    nkpevnqk
    

    Sequence, based on observed residues (ATOM records): (download)
    >4a5yA (A:)
    kniqvvvrcrpfnlaerkasahsivecdpvrkevsvrtggladkssrktytfdmvfgast
    kqidvyrsvvcpildevimgynctifaygqtgtgktftmegerspneeytweedplagii
    prtlhqifekltdngtefsvkvslleiyneelfdllnpssdvserlqmfddprnkrgvii
    kgleeitvhnkdevyqilekgaakrttaatlmnayssrshsvfsvtihmketeelvkigk
    lnlvdlagsenrareagninqslltlgrvitalvertphvpyreskltrilqdslggrtr
    tsiiatispaslnleetlstleyahraknilnkp
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4a5yB (B:)
    masqpnssakkkeekgkniqvvvrcrpfnlaerkasahsivecdpvrkevsvrtggladk
    ssrktytfdmvfgastkqidvyrsvvcpildevimgynctifaygqtgtgktftmegers
    pneeytweedplagiiprtlhqifekltdngtefsvkvslleiyneelfdllnpssdvse
    rlqmfddprnkrgviikgleeitvhnkdevyqilekgaakrttaatlmnayssrshsvfs
    vtihmkettidgeelvkigklnlvdlagsenigrsgavdkrareagninqslltlgrvit
    alvertphvpyreskltrilqdslggrtrtsiiatispaslnleetlstleyahraknil
    nkpevnqk
    

    Sequence, based on observed residues (ATOM records): (download)
    >4a5yB (B:)
    kniqvvvrcrpfnahsivecdpvrkevsvktytfdmvfgastkqidvyrsvvcpildevi
    mgynctifaygqtgtgktftmegerspneeytweedplagiiprtlhqifekltdngtef
    svkvslleiyneelfdllnpssdvserlqmfddprnkrgviikgleeitvhnkdevyqil
    ekgaakrttaatlmnayssrshsvfsvtihmkvkigklnlvdlagsennqslltlgrvit
    alvertphvpyreskltrilqdslggrtrtsiiatispaslnleetlstleyahraknil
    nk
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4a5yC (C:)
    masqpnssakkkeekgkniqvvvrcrpfnlaerkasahsivecdpvrkevsvrtggladk
    ssrktytfdmvfgastkqidvyrsvvcpildevimgynctifaygqtgtgktftmegers
    pneeytweedplagiiprtlhqifekltdngtefsvkvslleiyneelfdllnpssdvse
    rlqmfddprnkrgviikgleeitvhnkdevyqilekgaakrttaatlmnayssrshsvfs
    vtihmkettidgeelvkigklnlvdlagsenigrsgavdkrareagninqslltlgrvit
    alvertphvpyreskltrilqdslggrtrtsiiatispaslnleetlstleyahraknil
    nkpevnqk
    

    Sequence, based on observed residues (ATOM records): (download)
    >4a5yC (C:)
    kniqvvvrcrpfnlaerkasahsivecdpvrkevsvrtggladkssrktytfdmvfgast
    kqidvyrsvvcpildevimgynctifaygqtgtgktftmegerspneeytweedplagii
    prtlhqifekltdngtefsvkvslleiyneelfdllnpssdvserlqmfddprnkrgvii
    kgleeitvhnkdevyqilekgaakrttaatlmnayssrshsvfsvtihmkettidgeelv
    kigklnlvdlagsenrareagninqslltlgrvitalvertphvpyreskltrilqdslg
    grtrtsiiatispaslnleetlstleyahraknilnkpe