PDB entry 4a5o

View 4a5o on RCSB PDB site
Description: Crystal structure of Pseudomonas aeruginosa N5, N10- methylenetetrahydrofolate dehydrogenase-cyclohydrolase (FolD)
Class: oxidoreductase
Keywords: oxidoreductase, hydrolase
Deposited on 2011-10-26, released 2011-11-16
The last revision prior to the SCOPe 2.06 freeze date was dated 2012-05-16, with a file datestamp of 2012-05-11.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.23605
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Bifunctional protein folD
    Species: Pseudomonas aeruginosa PAO1 [TaxId:208964]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4a5oa1, d4a5oa2
  • Chain 'B':
    Compound: Bifunctional protein folD
    Species: Pseudomonas aeruginosa PAO1 [TaxId:208964]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4a5ob1, d4a5ob2
  • Chain 'C':
    Compound: Bifunctional protein folD
    Species: Pseudomonas aeruginosa PAO1 [TaxId:208964]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4a5oc1, d4a5oc2
  • Chain 'D':
    Compound: Bifunctional protein folD
    Species: Pseudomonas aeruginosa PAO1 [TaxId:208964]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4a5od1, d4a5od2
  • Heterogens: GOL, PEG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4a5oA (A:)
    ghmtaqlidgkaiaanlrqqiaqrvterrqqglrvpglavilvgtdpasqvyvahkrkdc
    eevgflsqaydlpaetsqddllalidrlnddpaidgilvqlplpahldaslllerihpdk
    dvdgfhpynigrlaqrmpllrpctpkgimtllastgadlygmdavvvgasnivgrpmale
    lllggctvtvthrftrdladhvsradlvvvaagkpglvkgewikegaividvginrqadg
    rlvgdveyevaaqraswitpvpggvgpmtracllentlhaaehlhd
    

    Sequence, based on observed residues (ATOM records): (download)
    >4a5oA (A:)
    taqlidgkaiaanlrqqiaqrvterrqqglrvpglavilvgtdpasqvyvahkrkdceev
    gflsqaydlpaetsqddllalidrlnddpaidgilvqlplpahldaslllerihpdkdvd
    gfhpynigrlaqrmpllrpctpkgimtllastgadlygmdavvvgasnivgrpmalelll
    ggctvtvthrftrdladhvsradlvvvaagkpglvkgewikegaividvginrqadgrlv
    gdveyevaaqraswitpvpggvgpmtracllentlhaaehlhd
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4a5oB (B:)
    ghmtaqlidgkaiaanlrqqiaqrvterrqqglrvpglavilvgtdpasqvyvahkrkdc
    eevgflsqaydlpaetsqddllalidrlnddpaidgilvqlplpahldaslllerihpdk
    dvdgfhpynigrlaqrmpllrpctpkgimtllastgadlygmdavvvgasnivgrpmale
    lllggctvtvthrftrdladhvsradlvvvaagkpglvkgewikegaividvginrqadg
    rlvgdveyevaaqraswitpvpggvgpmtracllentlhaaehlhd
    

    Sequence, based on observed residues (ATOM records): (download)
    >4a5oB (B:)
    mtaqlidgkaiaanlrqqiaqrvterrqqglrvpglavilvgtdpasqvyvahkrkdcee
    vgflsqaydlpaetsqddllalidrlnddpaidgilvqlplpahldaslllerihpdkdv
    dgfhpynigrlaqrmpllrpctpkgimtllastgadlygmdavvvgasnivgrpmalell
    lggctvtvthrftrdladhvsradlvvvaagkpglvkgewikegaividvginrqadgrl
    vgdveyevaaqraswitpvpggvgpmtracllentlhaaehlhd
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4a5oC (C:)
    ghmtaqlidgkaiaanlrqqiaqrvterrqqglrvpglavilvgtdpasqvyvahkrkdc
    eevgflsqaydlpaetsqddllalidrlnddpaidgilvqlplpahldaslllerihpdk
    dvdgfhpynigrlaqrmpllrpctpkgimtllastgadlygmdavvvgasnivgrpmale
    lllggctvtvthrftrdladhvsradlvvvaagkpglvkgewikegaividvginrqadg
    rlvgdveyevaaqraswitpvpggvgpmtracllentlhaaehlhd
    

    Sequence, based on observed residues (ATOM records): (download)
    >4a5oC (C:)
    taqlidgkaiaanlrqqiaqrvterrqqglrvpglavilvgtdpasqvyvahkrkdceev
    gflsqaydlpaetsqddllalidrlnddpaidgilvqlplpahldaslllerihpdkdvd
    gfhpynigrlaqrmpllrpctpkgimtllastgadlygmdavvvgasnivgrpmalelll
    ggctvtvthrftrdladhvsradlvvvaagkpglvkgewikegaividvginrqadgrlv
    gdveyevaaqraswitpvpggvgpmtracllentlhaaehlhd
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >4a5oD (D:)
    ghmtaqlidgkaiaanlrqqiaqrvterrqqglrvpglavilvgtdpasqvyvahkrkdc
    eevgflsqaydlpaetsqddllalidrlnddpaidgilvqlplpahldaslllerihpdk
    dvdgfhpynigrlaqrmpllrpctpkgimtllastgadlygmdavvvgasnivgrpmale
    lllggctvtvthrftrdladhvsradlvvvaagkpglvkgewikegaividvginrqadg
    rlvgdveyevaaqraswitpvpggvgpmtracllentlhaaehlhd
    

    Sequence, based on observed residues (ATOM records): (download)
    >4a5oD (D:)
    taqlidgkaiaanlrqqiaqrvterrqqglrvpglavilvgtdpasqvyvahkrkdceev
    gflsqaydlpaetsqddllalidrlnddpaidgilvqlplpahldaslllerihpdkdvd
    gfhpynigrlaqrmpllrpctpkgimtllastgadlygmdavvvgasnivgrpmalelll
    ggctvtvthrftrdladhvsradlvvvaagkpglvkgewikegaividvgigdveyevaa
    qraswitpvpggvgpmtracllentlhaaehlh