PDB entry 4a5g

View 4a5g on RCSB PDB site
Description: Raphanus sativus anionic peroxidase.
Class: oxidoreductase
Keywords: oxidoreductase, glycoprotein
Deposited on 2011-10-25, released 2012-11-07
The last revision prior to the SCOPe 2.05 freeze date was dated 2013-01-16, with a file datestamp of 2013-01-11.
Experiment type: XRAY
Resolution: 2.05 Å
R-factor: 0.164
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: anionic peroxidase
    Species: RAPHANUS SATIVUS [TaxId:3726]
    Database cross-references and differences (RAF-indexed):
    • PDB 4A5G (Start-307)
    Domains in SCOPe 2.05: d4a5ga_
  • Chain 'B':
    Compound: anionic peroxidase
    Species: RAPHANUS SATIVUS [TaxId:3726]
    Database cross-references and differences (RAF-indexed):
    • PDB 4A5G (0-End)
    Domains in SCOPe 2.05: d4a5gb_
  • Heterogens: HEM, CA, NAG, 1PE, PG0, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4a5gA (A:)
    ggslnatfyagtcpnasamvrtivqqafqsdsrigaslirlhfhdcfvlgcdasilldns
    gsiiseknagpnansargfnvvdniktalenacpgvvsctdvlalasqasvslsggpswt
    vdlgrrdtltanqaganssipsptqglsnitskfsavglntndlvalsgahtfgratcgv
    fsnrlfnfsgkgnpdptlnttllstlqelcpqkgrgsgstnldlstpdafdnnyftnlqs
    nngllqsdqelfsttgsatiaivtsfasnqtlffqafaqsminmgnispltgssgeirld
    ckktngsg
    

    Sequence, based on observed residues (ATOM records): (download)
    >4a5gA (A:)
    gslnatfyagtcpnasamvrtivqqafqsdsrigaslirlhfhdcfvlgcdasilldnsg
    siiseknagpnansargfnvvdniktalenacpgvvsctdvlalasqasvslsggpswtv
    dlgrrdtltanqaganssipsptqglsnitskfsavglntndlvalsgahtfgratcgvf
    snrlfnfsgkgnpdptlnttllstlqelcpqkgrgsgstnldlstpdafdnnyftnlqsn
    ngllqsdqelfsttgsatiaivtsfasnqtlffqafaqsminmgnispltgssgeirldc
    kktngsg
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4a5gB (B:)
    ggslnatfyagtcpnasamvrtivqqafqsdsrigaslirlhfhdcfvlgcdasilldns
    gsiiseknagpnansargfnvvdniktalenacpgvvsctdvlalasqasvslsggpswt
    vdlgrrdtltanqaganssipsptqglsnitskfsavglntndlvalsgahtfgratcgv
    fsnrlfnfsgkgnpdptlnttllstlqelcpqkgrgsgstnldlstpdafdnnyftnlqs
    nngllqsdqelfsttgsatiaivtsfasnqtlffqafaqsminmgnispltgssgeirld
    ckktngsg
    

    Sequence, based on observed residues (ATOM records): (download)
    >4a5gB (B:)
    ggslnatfyagtcpnasamvrtivqqafqsdsrigaslirlhfhdcfvlgcdasilldns
    gsiiseknagpnansargfnvvdniktalenacpgvvsctdvlalasqasvslsggpswt
    vdlgrrdtltanqaganssipsptqglsnitskfsavglntndlvalsgahtfgratcgv
    fsnrlfnfsgkgnpdptlnttllstlqelcpqkgrgsgstnldlstpdafdnnyftnlqs
    nngllqsdqelfsttgsatiaivtsfasnqtlffqafaqsminmgnispltgssgeirld
    ckktngs