PDB entry 4a52

View 4a52 on RCSB PDB site
Description: NMR structure of the imipenem-acylated L,D-transpeptidase from Bacillus subtilis
Class: transferase
Keywords: transferase, peptidoglycan, antibiotic resistance, cysteine protease
Deposited on 2011-10-24, released 2012-05-30
The last revision prior to the SCOPe 2.07 freeze date was dated 2014-01-15, with a file datestamp of 2014-01-10.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: putative l, d-transpeptidase ykud
    Species: BACILLUS SUBTILIS SUBSP. SUBTILIS STR. 168 [TaxId:224308]
    Database cross-references and differences (RAF-indexed):
    • Uniprot O34816 (4-166)
      • expression tag (0-3)
      • expression tag (167-168)
    Domains in SCOPe 2.07: d4a52a1, d4a52a2, d4a52a3, d4a52a4
  • Heterogens: IM2

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4a52A (A:)
    grklltyqvkqgdtlnsiaadfristaallqanpslqagltagqsivipglpdpytipyh
    iavsigaktltlslnnrvmktypiavgkiltqtptgefyiinrqrnpggpfgaywlslsk
    qhygihgtnnpasigkavskgcirmhnkdvielasivpngtrvtinrgshhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4a52A (A:)
    grklltyqvkqgdtlnsiaadfristaallqanpslqagltagqsivipglpdpytipyh
    iavsigaktltlslnnrvmktypiavgkiltqtptgefyiinrqrnpggpfgaywlslsk
    qhygihgtnnpasigkavskgcirmhnkdvielasivpngtrvtinrgs