PDB entry 4a4p

View 4a4p on RCSB PDB site
Description: crystal structure of the Sec7 domain from human cytohesin1
Class: signaling protein
Keywords: all alpha, guanine-nucleotide releasing factor, signaling protein
Deposited on 2011-10-19, released 2012-10-31
The last revision prior to the SCOPe 2.06 freeze date was dated 2012-10-31, with a file datestamp of 2012-10-26.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.1762
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cytohesin1
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4a4pa_
  • Chain 'B':
    Compound: cytohesin1
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4a4pb_
  • Heterogens: GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4a4pA (A:)
    hhhhhhnkqvamgrkkfnmdpkkgiqfliendllkntcediaqflykgeglnktaigdyl
    gerdefniqvlhafvelheftdlnlvqalrqflwsfrlpgeaqkidrmmeafaqrycqcn
    ngvfqstdtcyvlsfaiimlntslhnpnvkdkptverfiamnrgindggdlpeellrnly
    esiknepfkipe
    

    Sequence, based on observed residues (ATOM records): (download)
    >4a4pA (A:)
    nkqvamgrkkfnmdpkkgiqfliendllkntcediaqflykgeglnktaigdylgerdef
    niqvlhafvelheftdlnlvqalrqflwsfrlpgeaqkidrmmeafaqrycqcnngvfqs
    tdtcyvlsfaiimlntslhnpnvkdkptverfiamnrgindggdlpeellrnlyesikne
    pfkipe
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4a4pB (B:)
    hhhhhhnkqvamgrkkfnmdpkkgiqfliendllkntcediaqflykgeglnktaigdyl
    gerdefniqvlhafvelheftdlnlvqalrqflwsfrlpgeaqkidrmmeafaqrycqcn
    ngvfqstdtcyvlsfaiimlntslhnpnvkdkptverfiamnrgindggdlpeellrnly
    esiknepfkipe
    

    Sequence, based on observed residues (ATOM records): (download)
    >4a4pB (B:)
    nkqvamgrkkfnmdpkkgiqfliendllkntcediaqflykgeglnktaigdylgerdef
    niqvlhafvelheftdlnlvqalrqflwsfrlpgeaqkidrmmeafaqrycqcnngvfqs
    tdtcyvlsfaiimlntslhnpnvkdkptverfiamnrgindggdlpeellrnlyesikne
    pfkipe